KEGG   Ziziphus jujuba (Chinese jujube): 107421441Help
Entry
107421441         CDS       T04794                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like isoform X2
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00511  Other glycan degradation
zju00600  Sphingolipid metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107421441
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107421441
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107421441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 107421441
NCBI-ProteinID: XP_015886167
Position
6
AA seq 950 aa AA seqDB search
MENDLKEGEGEREFPCDSSLNKVDPGKPASLTWQRKLNYNGNMPSEFNVSFKESMHMISM
GFRLWRYGKEEAANGRLPIFDMFTKRSVTCHHGIPLGGIGAGSIGRSYRGEFQEFQLFPL
TFEDSPVLANQFSVFVSRPNGEKFSTVLCSRSPEVPKEAKSPGIESWDWNMNAEKCTYHA
LYPRAWTIYDGTPDPELEIVSRQVSPFIPHNYKESSFPVSVFTFTLSNKGRTSANVTLNF
TWANSVGGDSGNSGHHFNSKMMTEDGVHGVLLHHKTAKGHPPVTFAIAAEETADVHISKC
PCFVISGDSQGIITAEDMWHEIKKYGSFDHLDSNEKLMPSKPGSSIGAAIAASLSIPSGA
AKTVTFSLAWDCPEVRFSGKTYHSRYTKFYGSNGDAAENIARDAIIEHAKWESQIEAWQR
PILEDKRLPEWYPITLFNELYYLNAGGTIWTDGLPPMQSFIALGRRKFSIDCSKLNSKDT
INGLHENDTAIQILERMSSVFEQIHTPETANPAFGTSLLQSDEENIGQFLYLEGKEYLMW
NTYDVHFYSSYALLMLFPKIELSIQRDFAAAVMMHDPGLMKIMSDGKRVPRKILGAVPHD
MGLNDPWFEINAYNLFNSAKWKDLNSKFVLQVYRDMVATGDKNFAKAVWPSVYMAMAFMD
QFDKDGDGMIENEGFPDQTYDAWPVTGVSAYCGGLWLAALQAASAMAHELGDHASANYFL
VRYQNAKGVYDTLWNGSYFNYDNSGGSCSASIQADQMAGQWYSRACGLSPIVDEHKVRSA
LEKVYNFNVLKVKGGSRGAVNGMLPDGRVDMTGMQSREIWPGVTYSVAATMIQEGMVDMA
FQTAAGIHEAAWSQQGLGYSFQTPEGWNTDDQYRALGYMRPLAIWAMQWALSSPKPLKTQ
TKLEPMEAHLYSTQHARFSNVASVLKLPKEEDDKSFLQIVYDFTCRRFLL
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgatttgaaagaaggagaaggtgaaagagaatttccctgtgattcttctcta
aacaaggttgatcctgggaagcctgcttcacttacttggcaaaggaagttgaattataat
ggaaatatgccttcagagttcaatgtttcatttaaagagtcaatgcatatgatttcaatg
gggtttcgattatggcgatatggcaaagaagaagccgcaaatggaagactaccaatattc
gacatgttcacaaagaggtccgtcacatgtcatcatggcattcctttaggtggaattggt
gcaggaagtattggaagaagttacagaggggagtttcaagagttccagctatttcctttg
acatttgaagacagtccagttttagcaaaccagttttctgttttcgtttcacggcccaac
ggtgagaagttttcaactgtattatgctcaaggagcccggaggtgccaaaagaagctaaa
tcccctggcattgaatcttgggattggaatatgaatgctgagaaatgtacataccatgct
ttgtatccaagggcttggacaatatatgatggtacacctgatccagaacttgaaattgtt
tcacgtcaagtctctccatttattccccacaattacaaggaaagcagtttccctgtatcg
gtatttaccttcacgctatctaataaaggaagaacatctgcaaatgttaccttgaatttt
acatgggctaattctgtcggtggagactctggaaattcaggtcatcacttcaactcaaag
atgatgacagaagatggagtgcatggtgtacttttacatcacaaaactgcaaaaggacac
cctcctgttacttttgccattgcagcagaggaaaccgctgatgtccatatctcgaaatgt
ccttgctttgtaatatccggtgattcccaaggcatcatcacagcagaagatatgtggcat
gaaataaaaaagtatggatcgtttgaccacctagatagcaatgagaagttgatgccttcg
aaaccaggatcatctattggagcagccattgcagcctctttgagtatcccttctggtgct
gcaaagactgtcacgttttctctggcttgggactgcccagaagtgagatttagtggaaaa
acttaccacagccgctacacaaaattttatggttctaatggagatgcggcagaaaacatt
gcacgcgatgccatcattgaacatgccaagtgggaatcccagatagaagcatggcaaagg
ccaattctagaagacaaaagacttcctgaatggtatccaatcactctcttcaacgagctc
tattatctcaacgcaggggggacaatttggacagatggattgcctccaatgcaaagtttc
atagcccttggcaggagaaaattttccattgattgttctaaattaaattcaaaagatacc
attaacggtttacatgaaaatgacaccgctatacaaattctcgaaaggatgagttctgta
tttgagcaaatacatactccagaaacagcaaatcctgcttttggcaccagtttgctccaa
agtgatgaagaaaatattggacagtttctttatcttgaaggaaaagaataccttatgtgg
aacacttacgatgttcatttttactcctcctatgcattgctcatgctattcccgaaaatc
gaactcagcatccaaagagactttgcagcagcagtgatgatgcatgatcctggcctgatg
aaaatcatgagtgatggaaaacgtgttccacgaaagattcttggtgctgttcctcatgat
atgggactaaatgatccttggtttgaaataaatgcttataacctatttaattcagctaaa
tggaaagatttgaattccaagtttgttcttcaagtttacagggatatggttgctactggt
gataagaattttgccaaagctgtttggccctcagtttatatggcaatggcttttatggat
caatttgataaggacggagatgggatgatcgaaaatgaaggctttccggaccagacttat
gatgcatggcctgttactggtgtgagtgcatattgtggtggcctttggttagcagccctc
caagctgcttcagcaatggcacatgaactcggtgatcatgcatctgcaaattactttttg
gttagatatcaaaacgcaaaaggtgtatatgacacattatggaatggttcatacttcaat
tatgacaatagtggtggtagctgcagtgcatctattcaagctgatcaaatggcaggacaa
tggtacagcagagcatgtggtctgtctccaattgtggatgaacacaaagtgaggagtgca
cttgagaaagtctacaatttcaatgtcttgaaggttaagggtggttcacgtggagcagtg
aacgggatgctgccggatggaagagttgacatgactggaatgcaatctagagaaatttgg
cctggtgtaacatattctgttgctgctacaatgattcaagagggaatggtggacatggca
tttcaaactgcagctggtattcatgaagcagcctggtctcaacaaggtcttggttattct
tttcagaccccagagggttggaataccgatgaccaatatagagctcttggttatatgaga
ccattggccatatgggcaatgcagtgggctttgtcaagtcccaaacccctcaagacacaa
acaaaacttgaacccatggaagcccatttatactccacacaacatgcaagattttcaaat
gttgcaagcgttttaaagttgcccaaggaagaagatgataaaagcttcttgcagattgtt
tatgatttcacttgcagaagatttttactctaa

DBGET integrated database retrieval system