KEGG   Ziziphus jujuba (Chinese jujube): 107421651Help
Entry
107421651         CDS       T04794                                 

Definition
(RefSeq) serine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00340  Histidine metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107421651
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     107421651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107421651
NCBI-ProteinID: XP_015886416
Position
6
AA seq 596 aa AA seqDB search
MNESNFPHLKRWSSLCQPKVFGGLWFRRVEDMNKASLTKLGWKVSTEPASVWIQCVKARY
WKGRCFFSLFPRQNNSWGWKNILATRDLLKKSCCFKIGDGSTVDIWSDPWIPWKEGFMAK
LELNIEFCKFFLEPVPAEVLSNGDLGYGEGDENNNNNNNNDNKTQEKKREIVLGRNVHTT
CLAVTEPEANDEFTGDKDAYMASVLARYRKTLLERTKYHLGYPYNLDFDYGALGQLQHFS
INNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNDYWGYITNCGTEGNLHGILVGRE
VLPDGILYGSKESHYSVFKAARMYRMECVKVETLVSGEIDCADFKVKLLANKDKPAIINV
NIGTTVKGAVDDLDLVIQTLEECGFTQDRFYIHCDGALFGLMMPFVKRAPKVSFKKPIGS
VSVSGHKFVGCPMPCGVQITRLEHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNR
KGYKGFQKEVQKCLRNAHYLKDRLLEAGISAMLNELSSTVVFERPLDEDFVRRWQLACQG
NIAHVVVMPNVTIDKLNDFLNELVEKRSTWYQDGKVKPPCIAADVGTASCLCGLHK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaagcaattttccccatttgaaaagatggagttctttgtgccaaccaaaagtt
tttggtggactttggtttagaagagtggaggatatgaataaagcttcattgactaaactt
ggatggaaggtttcaacagagcctgctagtgtttggattcaatgtgttaaagcaagatac
tggaaaggtagatgtttcttctctttgtttccaagacaaaataattcttggggatggaag
aatatacttgctacaagagatctgctaaagaaaagttgttgctttaaaattggagatggt
tccacagtggatatttggtcagacccttggattccttggaaggaaggatttatggccaaa
ctggaattaaacatcgagttttgcaaatttttcttggaaccagtgcctgcggaggttcta
tccaacggtgatctgggatatggagaaggagacgaaaacaacaacaacaacaacaacaac
gacaacaagacgcaagagaaaaagcgagagatagtgcttggccggaacgtgcacaccacg
tgcctcgccgtcaccgagcccgaagccaacgacgagttcactggcgacaaggacgcttac
atggccagtgtcctcgctcgctacagaaagaccctcctggagaggaccaaataccatctg
gggtacccgtacaacttggacttcgattacggagcgctggggcagttgcagcatttctca
atcaacaatctcggtgatccattcatcgaaagcaactatggcgtccattccagacagttt
gaagtaggtgtgttggactggtttgctcgcctttgggaaattgagaagaatgattactgg
ggatacatcaccaattgcggtacggaagggaatcttcatgggattttggtaggaagagaa
gtactcccagatgggattttgtacggctccaaagagtcccattactctgttttcaaagct
gctcgaatgtatagaatggagtgcgtgaaggttgagactcttgtatccggcgagattgac
tgtgctgattttaaggttaaactactagctaacaaggacaagcctgcaatcatcaatgtt
aatataggaacaactgtgaagggagctgtggatgatcttgatcttgtcatacaaacgctc
gaggaatgtgggttcacgcaggatcggttctatatccattgtgatggtgccttgtttgga
cttatgatgccttttgtcaaacgtgcaccgaaggttagtttcaagaagccaattggtagc
gtgagtgtctctggccacaagtttgtaggatgtccaatgccttgcggagttcagataaca
aggctggaacacattaacgtcctttcaaggaatgttgagtaccttgcttcgagggatgcc
actatcatgggaagtcggaacggccatgcgccaattttcctctggtacaccctaaacaga
aaaggttacaagggattccaaaaagaagtccagaagtgtctccgaaatgctcactatttg
aaggaccgccttcttgaagccgggatcagtgccatgctgaatgaactcagtagcacagtt
gtgtttgagcggcctctagatgaggattttgttcgtaggtggcagttagcatgccaagga
aatatagcccatgttgtggtgatgcctaatgtcaccattgataagctaaatgatttctta
aatgaattggttgaaaaacgctcgacctggtatcaggatggaaaagtcaaacctccttgt
attgccgctgatgtgggaactgcaagttgtctttgcgggctgcataagtga

DBGET integrated database retrieval system