KEGG   Ziziphus jujuba (Chinese jujube): 107422172Help
Entry
107422172         CDS       T04794                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107422172
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107422172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 107422172
NCBI-ProteinID: XP_015887071
Position
1
AA seq 546 aa AA seqDB search
MALARVGRNAMRRSGGSIGYSTSERTTFYEGEIPLKCSLSSLANANANGNSWYISSIGKV
NHMSFWSRGMRATPHSQYLSVEKIVEESDSENDDSRYPGLGATGPGEKPRVVVLGTGWAA
CRFLKGLNTKIYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALAASPNSY
FYLASCTGIDTDKHEVYCETNGNGSLPNEPYQFKVAYDKLVIGSGAEPLTFGIKGVKEHA
FFLREVTHAQEIRKKLLLNLMLSENPGITEEERKRLLHCVVIGGGPTGVEFSGELSDFIM
KDVRERYTHVKDYIQVTLIEANEILSSFDVGLRQYATNHLTKSGVRFRRGIVKEVHSKKI
VLNDGTDVPYGLLVWSTGVGPSEFVKSINLPKAPGGRIGVDEWLRVPSVEDVFAVGDCAG
FLEQTGRPVLPALAQVAEREGKFLVELFNKMGKQNVGKAFSVKDFPMGDPFVYKHLGSMA
TVGRYKALVDLRQSKDAKGISHAGFVSWLIWRSAYLTRVVSWRNRFYVAVNWATTFVFGR
DNSRIG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcaagggttggcaggaatgccatgagaaggtcaggaggctccattggctat
agcacaagtgagaggaccaccttttatgagggagaaatcccactcaagtgttccctatcc
tcccttgcaaatgccaacgcaaatggaaattcttggtacatatctagcattgggaaggtg
aatcatatgagtttctggagcaggggaatgagggcaacaccacattctcagtatctttct
gtggagaagattgtagaggaatctgattcagagaacgatgatagcaggtatccaggacta
ggagcaacagggccaggtgaaaagccgagggtggttgtccttggtactggctgggctgcc
tgtcgattccttaagggactgaacaccaagatttatgatgtcgtctgcatatcgcctagg
aatcacatggtcttcactcctttgcttgcttccacttgtgtgggaacgctggaatttcga
tctgtagctgaacccgttagtcgtatacagtctgcattggcagcaagtccaaattcatac
ttctatttggcttcctgcactggcattgacacggacaaacatgaggtgtactgtgagacc
aatggaaacggcagtttacctaatgagccttaccaatttaaagttgcttatgacaagctc
gtcattggctctggagctgagcccttgacatttggtataaagggtgtgaaggagcatgca
tttttccttcgtgaagtaactcatgcccaagaaattaggaagaagctcctcttgaacctg
atgctctctgaaaatcctggaataacagaagaagaaaggaaacgcctgctacactgtgtt
gtcatcggtggtggtcctacaggggtggagttcagtggtgaattaagtgattttatcatg
aaagatgtccgtgaaaggtacacccacgttaaggattacatccaagtaacccttattgag
gcaaatgaaatcctatcatccttcgatgtcgggttaagacaatatgcaacaaaccattta
accaagtctggtgttcgctttaggcgtggtattgtgaaagaggtgcattctaagaagata
gttcttaatgatggaactgatgtaccatatggtctattagtctggtctacaggcgttgga
ccgtctgagtttgtaaaatcaattaatcttcctaaggccccaggtggaagaatcggcgtt
gatgaatggttgagagttccttctgttgaagatgtgtttgctgttggggattgtgctggt
ttccttgaacagacaggaaggccagtgcttccagcattagctcaggttgcagaaagagag
ggaaaatttctggtggagttgtttaacaaaatgggaaagcagaacgtgggaaaagccttc
agtgtaaaagacttcccaatgggagatccttttgtgtacaaacaccttggaagcatggca
acagttggacgttacaaggccctggttgatttacgccagtctaaggacgccaaaggcata
tcccatgctgggtttgtcagctggttgatttggagatcagcctaccttactcgtgttgtg
agttggagaaacaggttctatgtggcagtgaattgggcaaccacgtttgtgtttggcaga
gataactctagaattggctga

DBGET integrated database retrieval system