KEGG   Ziziphus jujuba (Chinese jujube): 107423369Help
Entry
107423369         CDS       T04794                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00480  Glutathione metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107423369
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zju02000]
    107423369
Enzymes [BR:zju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107423369
Transporters [BR:zju02000]
 Other transporters
  Pores ion channels [TC:1]
   107423369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 107423369
NCBI-ProteinID: XP_015888403
Position
7
AA seq 220 aa AA seqDB search
MEEEVVLLDFWGSMFGMRVRIALAEKGIKYEYREEDLPHKKSPLLLQMNPIHKKVPVLIH
NGKPICESLIIVEYIDEVWKNIGSPLMPSDPFHRAHARFWADFIDKKIYSAGTKVWKTKG
EEKPKKEFFDILKVVEGELGEKQYFGGDTFSFVDIALITYYSWFYAYETLGKFSIKAECP
KLIAWVKRCLQKESVSKTLPDGEKVLEFVLLLRKFYGLDK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaggtggttctgttggatttctggggaagcatgttcggcatgagggtcaga
atagccttggctgagaagggaatcaagtacgagtacagagaagaagatttgccacacaag
aaaagcccactgcttctgcagatgaacccgattcacaagaaagtccctgttctcatccac
aatggaaaacccatctgtgaatccctcatcattgtggagtatatcgatgaagtttggaag
aatattggatctccattgatgccctctgatcctttccacagagcccacgccaggttctgg
gcggacttcattgacaagaagatatatagtgctggaacgaaagtatggaagacaaaagga
gaagagaagcccaagaaagaattctttgatattttgaaggtggtagaaggagaacttgga
gagaagcaatactttgggggtgacacatttagttttgtagacatagcgctgatcacatac
tatagctggttttatgcctatgagactttgggaaaatttagcatcaaggccgaatgccct
aagcttatagcgtgggttaagagatgcctgcagaaggagagtgtctccaaaactcttcct
gatggagaaaaagttcttgagtttgttctgcttctaaggaagttttatggtcttgacaaa
taa

DBGET integrated database retrieval system