KEGG   Ziziphus jujuba (Chinese jujube): 107425455Help
Entry
107425455         CDS       T04794                                 

Definition
(RefSeq) non-functional pseudokinase ZED1-like isoform X2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zju01001]
    107425455
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107425455
Protein kinases [BR:zju01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107425455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 107425455
NCBI-ProteinID: XP_015890944
Position
8
AA seq 338 aa AA seqDB search
MELIGHLFPVMGKKKEKKEEEKNMVKNGGIVLEEVISTGNGRCNPIRIFSVEQLKNATNN
FQSPCFGNDHEPNWFKACLNNRPVLIRTSFRQGYMTSELAGRDIAITSQMSSHNRVLKLI
GCCLELPVPALVYEDNESVPLNTRGYISDNGSALPWKTRLRIAKDVASVLTYLHTTFSTP
IVYRNVKPSHVFLDKDFVPKLCNFSLSISIPKGETRVEDQVAGTWGFIDPEYFETSFVTE
QSDVYGFGAFLLVLLTGKSLRDCLHSLTDFDRLIDFVQEKPWDEVVDPKILEEEGVIEEE
HKLQALQNLVLRCIQTKADDRPMMIDVAKELLQIHRDC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaattgatcggacatctctttccggtgatgggaaagaagaaagaaaaaaaggaggaa
gaaaaaaatatggtgaaaaatggaggcatagtgttggaggaggtgatatctacagggaat
ggtagatgtaatccaattcgtatcttctctgtcgaacaactcaaaaacgccacaaacaat
tttcaatcaccttgctttggaaacgatcatgaaccaaattggttcaaggcttgtttaaac
aaccgcccggttctaatcaggacttcttttagacaaggatacatgacaagtgaattggca
ggtcgagacatagctataacatctcagatgagcagtcacaatagggttctgaaactaata
ggttgctgtctagagctgcctgttccagccttggtttatgaagataatgaaagtgtacca
cttaatacacgtggatatattagtgataatggctcagcgctcccatggaagacgaggtta
agaattgctaaggacgttgccagtgtgcttacctacctccacaccacattttccacgcct
atcgtctatcgaaatgtgaaaccttcacatgtgtttttagacaaggattttgttcccaag
ttgtgcaatttctctctctccatatcaattcctaagggtgagactcgtgttgaagatcaa
gtggcggggacatggggatttattgatcctgagtactttgaaacatcgtttgttacagag
caaagtgatgtctatggttttggagcatttctactggtcctcctaactggaaaatcactt
cgtgattgcctccatagtttgactgatttcgatcgtttgatagatttcgttcaagagaag
ccatgggatgaagtagtggatcctaaaatattggaagaggaaggagtaattgaagaagag
cataaactacaagctcttcaaaatttggtattgagatgcattcaaactaaggctgatgac
agaccaatgatgattgatgtggcaaaagaactccttcagatacacagagattgttaa

DBGET integrated database retrieval system