KEGG   Ziziphus jujuba (Chinese jujube): 107425646Help
Entry
107425646         CDS       T04794                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00350  Tyrosine metabolism
zju01100  Metabolic pathways
Module
zju_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107425646
Enzymes [BR:zju01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107425646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 Tom37 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 107425646
NCBI-ProteinID: XP_015891145
Position
8
AA seq 218 aa AA seqDB search
MSNHPLKLYSYWRSSCSYRVRIALNLKGLDYEYIPINLVKGEQFSPEFRKLNPIGYVPVL
VDGDVVISDSFAILLYLDEKYPQRPLLPTDIRKKAINYQAANIVSSSIQPLQNLAILKYI
EEKVSPDEKLPWVQCHIGKGFESLEMLLKDYAGKYATGDDIFLADLFLAPQIFSAQRFNV
DMNQFPLLSRLDEAYSELPAFQDAMPEKQPDAPSSGTS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcatccattgaagctctactcctactggaggagttcatgctcttaccgagtt
cgaatcgccctcaatctcaaaggacttgactatgagtatataccaatcaaccttgtaaaa
ggcgaacaattcagtccagagtttaggaagttgaatcctattggttatgtgccggtgctg
gtggatggggacgtagtaatttccgactcttttgctatattactgtatttggatgagaag
taccctcaacgtcctttgctgcctactgatattcgtaaaaaagccattaattaccaggct
gcaaatattgtttcctcaagcatacaacctcttcaaaatttagcaatactgaagtacatt
gaagaaaaagttagtccagatgagaaacttccttgggtccaatgtcatattggcaagggc
tttgaatcacttgaaatgctgctcaaagactatgctggaaaatatgcaactggggatgac
atttttctggccgacttattcctagcaccccagattttttcagctcaaaggttcaatgtt
gacatgaatcagttccctcttttgtccaggttggatgaggcttacagtgagctaccagca
ttccaagatgctatgccagaaaagcagcctgatgctccttcgtcaggcacaagttaa

DBGET integrated database retrieval system