KEGG   Ziziphus jujuba (Chinese jujube): 107425672Help
Entry
107425672         CDS       T04794                                 

Definition
(RefSeq) glutamate--tRNA ligase, chloroplastic/mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00860  Porphyrin and chlorophyll metabolism
zju00970  Aminoacyl-tRNA biosynthesis
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Module
zju_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107425672
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107425672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zju01007]
    107425672
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zju03016]
    107425672
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:zju02048]
    107425672
Enzymes [BR:zju01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     107425672
Amino acid related enzymes [BR:zju01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   107425672
Transfer RNA biogenesis [BR:zju03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107425672
 Prokaryotic Type
   Other AARSs
    107425672
Prokaryotic defense system [BR:zju02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    107425672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c Cellulase-like
Motif
Other DBs
NCBI-GeneID: 107425672
NCBI-ProteinID: XP_015891179
Position
1
AA seq 580 aa AA seqDB search
MATLVGTPWMRIRVFPEVAYPIFLPSSLCCRHRKFSDFVRTTTTRSFSVSASSITDHSKK
VEEPVRVRFAPSPTGNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTKESEEALL
QDLSWLGLDWDEGPGVGGEYGPYRQSERNSLYKRHAEKLLERDHVYRCFCTNEELEKMKE
IAKLKQLPPVYTGKWASATDEEVQEELAKGTPYTYRFRVPKEGSLKINDLIRGEVSWNLD
TLGDFVIMRSNGQPVYNFCVTVDDATMAISHVIRAEEHLPNTLRQALIYKALGFPMPYFA
HVSLILAPDRSKLSKRHGATSVGQFREMGYLPQAMVNYLALLGWGDGTENEFFTLEQLVE
KFSIGRVNKSGAIFDSTKLRWMNGQHLRVIPSEELTKLIGEQWKRTGILTESEGPFIDEA
VQLLKDGIDLIPDSDKALSNLLSYPLHATLTSPEAKPVLEDKLSEFSASLITAYDNGELL
SALEEGHAGWQKWVKSFGKSLKRKGKSLFMPLRVLLTGKLHGPDMGASVDLIHKAGIYGV
VAPQAGFVTLNERFKMLRQVDWEALIKDQHVAEAAASVSN
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttagtaggaacgccatggatgaggattagggtttttccagaagttgcatat
ccaatttttctcccatcttccctctgttgcagacacagaaaattctcggactttgttagg
acgacgacgacgaggagtttctcggtctcggcttcttccattactgatcattcaaagaag
gttgaggaaccagtacgtgttcgttttgctccttctcccactggcaatctgcatgttggt
ggagcgaggactgcactcttcaattatctctttgctaggtccaaaggagggaaatttgtt
ctgaggattgaagatactgatttggagaggtctactaaggagtctgaagaagccttgttg
caagatctgtcttggcttggtcttgattgggatgaaggacctggcgttggtggagaatat
ggtccatataggcaatcagaaagaaattctttgtacaagcgacatgctgagaagcttttg
gaacgtgatcatgtttatcgctgcttttgcaccaatgaggagctagagaaaatgaaggag
attgcaaaactaaaacaactgcctccagtatacactggaaagtgggccagtgcaacagat
gaagaagtacaagaagagttggcaaagggaaccccttacacgtataggtttcgtgtacca
aaagaagggagtttgaaaattaatgaccttatccgcggtgaggtcagttggaacttggac
acacttggagactttgtcattatgaggagcaatggacaacctgtatacaatttttgtgtc
acagtagatgatgccactatggctatttcacatgtaataagagctgaggaacatttacca
aatactctaaggcaagcattgatatataaggctttaggatttccaatgccttactttgcc
catgtttccttaattcttgcaccagatcgaagtaaactttcaaaacggcatggagcaact
tcagtggggcagtttagggagatggggtatctaccacaggcaatggtgaactacctggca
ctattagggtggggcgatggcactgaaaatgaatttttcactcttgagcaacttgttgaa
aagttctcaattggtcgcgttaataaaagtggtgctatttttgattctaccaagttaagg
tggatgaatggtcaacacttaagagtaattccctccgaggagttgacaaagcttattggt
gagcaatggaaaaggaccggcattctcacagagtcagaggggccatttattgatgaggca
gttcagctgctcaaggatgggattgacttaataccagattcagataaagcgctatcaaac
ttgctctcttatcctttacatgccactttaaccagtcctgaagccaaacctgtattggaa
gacaaactttctgaattttcagccagccttataactgcttatgacaatggtgaacttctt
agtgcacttgaagaaggtcatgctggttggcaaaagtgggtaaagagctttggaaaatca
ctgaagcgcaaggggaagtcacttttcatgccgctccgagtactactaacaggaaaactc
catggcccagatatgggagctagtgtggatttaattcataaagctggaatatatggagtt
gttgctccgcaagctgggtttgtgacattgaacgaaaggttcaaaatgctgaggcaagta
gactgggaagcattgatcaaggatcagcatgttgcggaggctgctgccagtgtatcaaat
tga

DBGET integrated database retrieval system