KEGG   Ziziphus jujuba (Chinese jujube): 107425886Help
Entry
107425886         CDS       T04794                                 

Definition
(RefSeq) cytochrome P450 94A2-like
  KO
K20769  fatty acid omega-hydroxylase [EC:1.14.-.-]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    107425886
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zju00199]
    107425886
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     107425886
Cytochrome P450 [BR:zju00199]
 Cytochrome P450, plant type
  CYP94 family
   107425886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 107425886
NCBI-ProteinID: XP_015891420
Position
9
AA seq 509 aa AA seqDB search
MNIPPQLLISSFLFILPLLFLYVFTKKKNKSSPNSTKQQLPKSYPLVGHYFSISPNQHRR
NQYTTEILQISPASTFVFRLLFGARRITTANPSVVQHILKTNFSIYQKGDAFRIPLTDFL
GDGIFNTDGDNWKFQRQVASHEFNTKSLRKFVETVVETELSDRLLPILSEAASDNSVLDF
QDLLQRFAFDNICKIAFGFDPAYLSPSLPDAKFALAFDEAVLISSQRSFSFVPWVWKIKK
IFGIGSEKQLAQSISEVRDFASHIVRGKKKELAEKSSLDSVDLLSRFLSSGHSDEKFVTD
IVISFILAGKDTTSAALTWFFWLVAVNPHVEKQILKEINEQSETSVYSEVKEMVYTQAAL
CESMRLYPPVPADTKDAVVDDVLPDGTVVKKGDKVTYHPYAMGRMENIWGKDWAEYRPER
WLEWNEESKKWSLVMRDSYSYPVFQAGPRICLGKEMAFLQMKRVAAGVLRRFRVVPAMAE
GTEPVFISYLTSKMKGGFPLRFVERGGTE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccctcctcaacttttaatatcctcattccttttcattcttccattgctcttc
ctctacgtcttcaccaagaaaaagaacaagtcatctcccaattcaaccaaacaacaactc
ccaaagtcatacccattagtcggtcattacttctccatctcacccaaccagcaccgccgc
aaccaatacaccaccgagattctccagatctctccggcctccaccttcgtcttccgccta
ttattcggcgcccgccggatcacaacggccaacccctccgtggtccagcacattctcaag
accaacttctccatctaccaaaaaggcgatgcctttagaattcccctaaccgacttcctc
ggcgacggtattttcaacaccgacggcgacaactggaagtttcagagacaggtcgccagc
cacgaattcaacacgaaatcgctccggaaattcgtcgagacggttgtggaaaccgagctc
tccgatcgtctgcttccgattctctcggaagccgcgtctgataattccgtcctcgatttc
caagacctactccagcggttcgctttcgacaacatctgcaagatcgctttcggattcgac
cccgcttacttatcaccatctcttccggatgcgaaattcgctctggctttcgacgaagcc
gttttgattagcagccaaaggagtttctccttcgtcccttgggtttggaaaatcaagaag
attttcggcatcggatcagaaaagcagcttgcgcaatcgatttcggaagtcagagatttc
gcctcccacattgtccgaggaaagaaaaaggaactcgccgagaaaagctctctcgattcc
gtcgatctgctgtctcggttcttgagctccggccattccgacgagaaattcgtcacggac
atagtcatcagcttcatactggcagggaaggacacaacctcggcggctctcacgtggttt
ttctggctcgtggctgtcaatccacatgtagagaagcaaattctgaaagaaatcaacgag
caatcagagacttcagtttacagcgaagtgaaagaaatggtatacactcaggccgcattg
tgcgagagcatgcggctctatcctccggttcctgcggatactaaagatgcggtggtggat
gacgtattgccagatggaacggtggtgaagaagggggataaggtgacgtaccatccatac
gcaatggggaggatggagaacatatggggaaaagattgggcggagtacagacccgaacgg
tggctggaatggaacgaggagagtaagaagtggagcttagtgatgagggactcctacagt
taccctgtgttccaggcagggccaaggatatgtttggggaaagaaatggcattcttgcag
atgaaaagggtggcagctggggttctgcgccggttccgggtggtgccggcaatggcggaa
gggactgagccggtgttcatttcttacttgacttccaaaatgaaaggtgggtttccgttg
aggtttgtggaaaggggtggaacagagtaa

DBGET integrated database retrieval system