KEGG   Ziziphus jujuba (Chinese jujube): 107427758Help
Entry
107427758         CDS       T04794                                 

Definition
(RefSeq) separase isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:zju01002]
    107427758
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zju03036]
    107427758
Enzymes [BR:zju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     107427758
Peptidases [BR:zju01002]
 Cysteine Peptidases
  Family C50: separase family
   107427758
Chromosome and associated proteins [BR:zju03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    107427758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 107427758
NCBI-ProteinID: XP_015893624
Position
9
AA seq 2227 aa AA seqDB search
MASTTEASLLSELESPSCSQGIHSLFSDYLHPFSDLKNPKKTKISAKSKTTDQSSIRSLA
KTFLPFLNRALSILPKRLADPSKFGGGGADDKLALEMFEIYRLCLDCLESLASQLSCKPY
SVQLQRVRMVHCLEAWGKFKEAENQGFRILKELKAIDFGGKVVKCQGRLLPDIDKGGGDK
DFVCLVVEIVVTLVKCVTMGRSKDGGDYRKVIRLVEEVRTWFRVLDANAYEKLQRVLVTY
LSRCTLFLVGEIPSFDEDLIHALCFTTMAEYSKSSMKDQVYKFAHRICSSLFSLQENRSS
LIIDMLICVLESVARETKVEEENNGIEFVEFVAYCANKCQTNTNFCSNIGAHLNKIASYF
HQVRTPFHLILRLYATGLFFISFIMKSRSGDLTCSGGVTRLLHDNVDILQNLSTLLGSLE
SFFHVGCKETCVSSRVDSKDSVCQVCSLSICDRKASMHWTQKSGKAHLLSYLNAYLNALK
FLCLPLAELVNSEKKTILSEHEASSVSNGICKIQDAFYQFSDVFFLYKRCRCTYEGERSG
FDENSMHAVAVAAFIVSIRTKHKMENSVAMFNDMISSEWIQPHGLKHLSTSLYNTGVILY
RNDQLKEASKALKLCCRASWTCAVRLCEMFVHKSKGLDGDLSEDAILDFVNESCRRTAFL
LDVLHQCDSQKIERTIVESLEKWSIAADVFRRLAGPMSMVKQWVKIECKYHKELNGEDIG
PTLYRALSSSEKMSKRTVGIILEQELVAYEEMNVLYPELCEKMQMKIIGFLLQEVYVTQD
NLLEKSRILVRKGRMLRNKGNDGLGDCIQCLSEAIALLEIFGETYSCGVPPSHELAVVYC
LRALCSQEFQPDSKQIFEDITAALNLWSSISTQDHFSANDKYFAKSENVMLLIYNIIDLL
SMKGFMEFHPDIYKLMIRLFQWNNVPSEKLLAILWECRRTGHGLCISPVNEAFIMSLLDH
YGEHSRSIDYWTSCLQGSQPLLIGLQHNFSFLFGNFAWGSNDHESSFRPDITVDEVEESA
FQLISSASVSSRSSFIAAYLFYDLSERLISNGQLIKALFYAKEAHRLRSKLFQEKFMYSV
GQQAEKCHETGDIVQKFTTLQNLKVRRSVASEFWSFDTISWNLENCYLSPWNVLQCYLES
TLQVGIVHELVGNGTEAETFFTWGKNISCSQSLPLFLLAFSCVLGKLYCKKQHWDLAERE
LQKAKQYLVTYGTNISCLKCRTMMEVTVDQHLGDLSLSIIDTASGKISPERLYHAEDLYK
SALDKLNLSHWKNSVSCPKESTAESMVLGNTTVKDFRNGVCHMFSLCKDQVDINKPSREG
SKCMESKKGRKPRNAPKPLSKDQGPILEKNVRSTRSMYRSSKNQNITSSDEIQFGHTKHL
KGNNDCDYSTTFSPEDVLMKMRSCKLVAGCEEMCVCHKNRCWLCLPMEVMRSGLIKDFIN
MKWEFVRRRISIRLLTSLGHCLENHGQIHEAHEIILQSISILVSRNPFCLTSSSIPVTFL
LDIIGKEISGDVFSIEHAELLYNISWLSLRAFSSKDTRIVCCDLSCIELPNIVGWLMLAF
VLGREVPVLSQKVSRLLAVMFLLSSSSDLSPLPSSCKALSKNHWASYFHQASVEAHHNYQ
FFTSNSGTAKVQHLVDSEGSCVTGSTCVGAETKNLSRVAPESLQDLEEFVEKFFSNLPCT
TVICISFLGGPYAILLQELLLYPSCVHSWILVTRMYSKGQPIVLLLPMDSIIEEISDDAA
NSGCSGFPHIKDLGGQWQCPWGSTVVDDMAPEFKLILEENYLSSSMFPFQDTKENRTIWW
KRRKKLDHRLGKLLRNMEESWLGPWKYVLLGECSNCKGLDSIHKKLMCDLKSKCKMDVNE
NLLKVILGVSKSAFEECGYVLQLCLRNGCYIGRGEFCGKDKCWPSSNEAEKLSGMAFQLI
CKALEELEGLDCVAREPVVLVLDFDIQMLPWENIPILRNQEVYRMPSVGSISTTLDRSHH
HQEQVGMAGAAFPYIDPLDAFYLLNPSGDLSSTQIELENWFRCQNLEGKAGYAPAAEELA
AALKSHDLFIYFGHGSGTQYIPRHEIQKLRNCAATLLMGCSSGSLTLNGCYVPQGTPLSY
LLAGSPAIIANLWEVTDKDIDRFGKAMLDSWLKERLSPCTSCVQSNLLEEFDSMSIKASK
GNAKKKNSRKKLPEVCERGSNRNYCEHRPKIGSFMGQAREACTLPFLIGASPVCYGVPTG
IRRKKNL
NT seq 6684 nt NT seq  +upstreamnt  +downstreamnt
atggcttccactaccgaagcctcacttctctccgagctcgaatccccttcctgttcccaa
ggcattcactccctcttctccgactacctccacccattttccgacctcaaaaaccccaag
aaaaccaagatatccgccaagtccaagaccaccgaccaatcctcaatccgatcgcttgcc
aagacattccttcctttcctcaaccgagccctatcgatcctccccaaacgcctcgccgat
ccttctaaatttggtggtggtggcgccgatgataaattggcactcgaaatgttcgaaatt
tacaggctttgtttggattgcttggaatctctggcttcgcagctgtcttgcaaaccgtac
tctgtacagctccagagagtacggatggtgcattgcttggaagcttggggaaagtttaag
gaagctgaaaatcaggggtttaggattttgaaggagctcaaggcgatcgattttggtggt
aaagtggtgaaatgccagggaagattattgccggatatcgacaaagggggtggtgataag
gattttgtgtgtttggttgtggagattgtggtgacgctcgtgaagtgcgtgacaatgggt
cgaagtaaggatggtggtgattataggaaggtgattcgtttggtggaggaggtaagaaca
tggttcagggtattagatgccaacgcatatgaaaaattgcagagggtgcttgtgacctat
cttagtaggtgtactctttttttagttggggagataccaagttttgatgaagatctgata
catgcattatgcttcacaacaatggctgagtattccaagtcatcaatgaaagatcaagtt
tacaagtttgctcataggatatgttcctctttattctcattacaagagaacagatcttcc
ctcatcattgacatgttaatatgcgtgttggaatctgttgcccgtgaaacaaaggttgaa
gaggaaaataatggaatagagtttgttgaattcgttgcttactgtgccaataagtgtcaa
acaaacacaaatttttgtagcaatattggagctcatttgaataaaatagccagttatttc
catcaggttaggacaccttttcatttgattctgaggctttacgctactgggttgttcttc
attagttttattatgaagtccagaagtggggatcttacatgctccggaggtgtaacaaga
cttttacatgataatgtggatattctgcagaacctttctactttacttggttcactagaa
agtttctttcatgttggctgcaaggaaacctgtgtgtcatccagggttgattctaaggat
tctgtttgtcaagtatgctcattatccatttgtgatcgcaaggcctctatgcattggaca
cagaagagtggaaaggctcatctgctgtcttacttaaatgcttacttaaatgcactgaag
ttcttatgcttgccgcttgctgaattagtaaattcagaaaagaagacgatactttctgaa
catgaagccagttctgtttctaatggaatatgtaaaatacaggatgcattctatcagttt
tctgatgttttctttctctataaaaggtgtagatgtacctatgaaggggagagatctgga
tttgatgaaaacagcatgcacgctgtagctgtggctgcatttattgtttccatcagaaca
aagcataagatggagaacagtgtggctatgtttaatgacatgatttccagtgaatggatt
caacctcatgggttaaaacatctttccacctctctttataacactggtgtaattctgtac
agaaatgaccaacttaaagaggcttcaaaagcattaaaattatgttgtagagcatcatgg
acttgtgctgtacgtctttgtgagatgtttgtgcacaagtcgaaggggttggatggtgat
ctgtcagaagatgctatactagattttgtcaatgaatcatgtagaagaactgctttcctt
ttggatgttctccaccaatgtgacagtcagaagatagaaagaacaatagtagagagcctt
gaaaagtggtctattgcagcagatgtcttcagaagactagcaggtcccatgtctatggtg
aaacagtgggtgaagattgaatgcaaatatcataaagaattaaatggtgaggatattggt
ccaaccttataccgtgcgctttcttcttctgagaaaatgtcaaagaggacagttgggatt
atcttggaacaggaacttgttgcatatgaagaaatgaatgtactgtacccagagttgtgt
gagaaaatgcaaatgaaaattataggtttcctcctgcaagaagtgtatgtaacacaggat
aatttgttagagaaatcaagaattttagtcagaaagggaaggatgctaaggaacaaaggg
aatgatggtctgggggattgtattcaatgcttgtcagaagcaatagctttacttgagata
tttggtgaaacatatagctgtggagttccacccagtcacgaattagctgtggtgtattgc
ttacgtgcactttgttctcaggagtttcaaccagactcaaagcaaatctttgaagatatc
actgctgccctaaacctatggtcgagcatttccactcaagatcatttctctgccaatgac
aagtactttgcaaagtctgaaaacgtgatgcttctaatttataatattattgatttgttg
tcaatgaagggtttcatggaatttcacccagatatatataagcttatgattagattattt
caatggaataatgttccatcagagaagttattggccatactttgggaatgtaggaggaca
ggccatggcctttgcatttcacctgttaatgaggcattcatcatgagcttactagaccat
tatggtgaacattccagatccattgattattggacaagttgtttacaaggatctcaacca
ttgctgattggactgcaacacaacttctcatttctatttggaaactttgcttggggttca
aacgatcatgaaagctcttttcgaccagatatcacagttgatgaagttgaagagtctgct
tttcaacttatttcaagtgcttctgtgtccagccgttctagtttcattgctgcatacctt
ttttatgatttgagcgaaagacttatttcaaatggacagttaataaaggcccttttttat
gcaaaagaagctcatcggttacgtagtaaattatttcaagagaaatttatgtattctgtg
ggacagcaggctgaaaagtgccacgaaactggggatatcgttcaaaagtttaccaccctt
cagaatttgaaagtgcgcagatctgtagctagtgaattttggtcctttgatacaatttca
tggaacttggaaaattgttatcttagcccttggaatgtacttcaatgttaccttgaaagc
actcttcaggttggcattgtccatgaactagtaggaaatggaacagaggctgaaactttt
tttacatggggaaaaaacatttcctgctcacaaagcttgccactatttttgcttgctttc
tcttgtgttttgggaaagttgtattgtaagaagcagcattgggatttggcagaaagagaa
cttcagaaagccaagcagtatttggtgacatacggcacaaatatttcttgcttaaagtgc
agaacgatgatggaagtaaccgttgatcagcatcttggtgatttatccctaagcattatt
gatactgctagtggaaaaatatctccagagagattgtatcatgctgaagatctgtataaa
tcagctcttgacaagctgaatctttctcattggaaaaattctgttagctgtcctaaagaa
tccactgctgaaagcatggtgcttggtaatactactgtcaaagattttcgaaatggtgtt
tgccatatgttttctctatgcaaagatcaagtggatataaataaaccatctagggagggg
tcaaagtgcatggagtctaaaaagggtagaaagcctaggaatgccccaaaacctttatca
aaggatcaaggtccaatacttgagaaaaatgtgaggtcaacccgttccatgtatcgatct
tctaagaaccaaaatattaccagttctgatgaaatacaatttggccatacaaaacatttg
aaaggcaataatgactgtgattattctactacttttagcccggaggatgtgctaatgaaa
atgagaagctgtaagcttgttgctgggtgtgaagaaatgtgtgtttgccacaagaatagg
tgttggctctgccttcctatggaagttatgagaagtgggttaataaaagattttataaac
atgaagtgggaatttgtccgcaggcggatttcgataaggctgcttacaagtttaggacat
tgcctggagaatcatggtcaaattcatgaagcacatgaaattatcttgcaaagcatatcg
atcctagttagccggaacccattttgtcttaccagctcatccattccagtcaccttctta
cttgatataattgggaaggagatctcaggagatgtattcagtattgagcatgcagaacta
ctatataatataagttggctttctttgagagctttcagttccaaggacactaggattgtt
tgctgtgatctgtcttgtattgagctaccaaacatagtaggttggttgatgctagctttt
gtgcttggccgagaggttcctgtgctttctcagaaggtttctagattgcttgctgttatg
tttttactttcttcctcaagtgatctttctcctttaccatcttcatgcaaagcactctcc
aaaaatcactgggcttcatattttcaccaagcttcagtcgaagctcatcataattatcaa
ttcttcaccagtaactctgggacagccaaagtccagcatcttgtagactctgagggttca
tgtgttactggctcaacttgtgtgggagctgaaacgaagaacttatcaagggttgcaccc
gagtctcttcaagatcttgaagaatttgtagagaaatttttttctaaccttccttgtaca
actgttatttgcataagttttcttggaggtccttatgctattctgttacaagagttgctg
ctttatccatcatgtgttcactcatggattctagtgacacgcatgtactctaagggtcaa
cctattgtcttgcttctgccaatggattccataatagaagaaatttccgatgatgctgca
aattctggctgtagtggcttccctcatatcaaagatttgggtggtcaatggcaatgtccc
tggggttccactgtggtggatgatatggctccagaatttaaactcatattagaggaaaat
tacttgtcatcttcaatgtttccttttcaagatacaaaagagaataggacaatttggtgg
aagcgaagaaagaagctcgatcaccgcctaggaaaattgctgaggaatatggaagagtca
tggttgggtccctggaaatatgtgcttctaggagaatgctcaaattgcaagggcctagac
tccatacataagaagctgatgtgtgatctgaaatctaaatgcaaaatggatgtaaatgag
aaccttcttaaagtcattcttggggtttccaagtctgcttttgaagaatgtggatatgtt
ttacagctatgtttaaggaacggttgctacattggtcggggtgaattttgtggcaaagat
aagtgctggccatcatctaatgaagctgagaaactgtctgggatggccttccaacttata
tgtaaagcattggaagaacttgaagggctagattgtgtcgctcgagaaccagtagtttta
gtattggactttgacattcagatgcttccatgggagaatataccaatattgagaaaccag
gaggtttatcgcatgccttcagttggaagcatttccaccacacttgatagaagccatcac
catcaagaacaagttggaatggctggtgctgcctttccttacatagatcccttggatgca
ttttatttattgaatcccagtggtgacctcagcagcacacaaattgaattggagaactgg
tttagatgtcaaaacttggaggggaaggctggatatgcacctgcagcagaagagttggct
gcagccttgaaaagtcatgacctctttatatattttggacatggaagtgggacacagtac
attccaaggcatgagattcagaaactgagaaactgtgctgcaactctcctgatgggatgc
agtagcggatctttgaccttaaacggatgttatgttccacaaggtactccactatcatat
ctgctggcaggttctcctgcaatcattgccaatctgtgggaagtgactgacaaggatatt
gatcgatttgggaaagccatgcttgattcttggttaaaagaaagattgagtccctgtact
agttgtgtacaaagcaatttattagaagaatttgattccatgtctataaaggcctctaaa
ggcaatgctaagaagaaaaactcaaggaagaaattgcctgaagtttgtgaaaggggttca
aataggaattattgtgaacataggccaaagattggatcatttatgggtcaagctcgtgaa
gcttgcacattacccttcttgattggtgcatcaccagtatgttatggtgttccaacaggt
ataaggagaaagaagaatttgtag

DBGET integrated database retrieval system