KEGG   Ziziphus jujuba (Chinese jujube): 107428387Help
Entry
107428387         CDS       T04794                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:zju00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107428387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zju03041]
    107428387
Enzymes [BR:zju01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107428387
Spliceosome [BR:zju03041]
 Complex C
  Other components
   Step II factors
    107428387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD ABC_tran AAA_30 AAA_19 T2SSE cobW Helicase_RecD AAA_16 MMR_HSR1 DUF2075 AAA_14 AAA_33 AAA_29 Sigma54_activ_2 DAP3 SRP54 ATPase_2 AAA_23
Motif
Other DBs
NCBI-GeneID: 107428387
NCBI-ProteinID: XP_024933867
Position
10
AA seq 700 aa AA seqDB search
MANLPIVQFEEKILETVEQHPVVVLIGETGSGKSTQLSQMLHRRGYTKSGIIGVTQPRRV
AAVSVARRVAQELDVPLGEEVGYAIRFEDRTSERTRIKYLTDGVMLRESLANPELNEYSV
IILDEAHERSLNTDILLGLMKRLVKRPASNLKVLITSATLDGDKVSKFFSNCPVMTVPGK
LYPVEILYSKERPKSYLETSLKTALDIHIKEPEGDVLIFMTGQDDIEKLVSKLEEKIRSL
EEGSCMDAIILPLHGSLPPEMQVRVFSPPPPNCRRIIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSTVYHDDFLDVTVPE
IQRSSLAGTVLYLKSLDLADIDILKFDFLDSPSSESLEDALKQLYLIDAIDENGLITKVG
RTMAELPLEPSLSRTLMAANEYGCLSQALTVAAMLSAETTLLPGRSKNTEKKRKHNHVDL
PDGSGWGDHIQLLQIFECWHRTNYDIDWCKDNGLQVRGMKFVKDVRKQLSQIMQKIAKGP
LDVETSRRWEESQHNYLNLRKALCTGYANQLAERMVYHNGYRTLGFKPQVVQVHPSSVLK
PDDDGKLPEYVLYHELIATSRPYLRSVCSVDIKWVTPIIEKVNKLNVIKLSGGINHIEEG
TEGINSNLPKKEVVVAGVPDKPDDRIQAARERFLARKGKK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccttcctattgtccaattcgaagagaaaattttagaaacggtggaacagcat
ccagttgtggttctaatcggagagaccggttcgggaaagagcacgcaactctctcagatg
ctgcaccgaagaggctataccaaatctggaatcatcggcgtcactcagccgcgccgagtt
gccgcagtctccgtcgcaagacgtgttgcacaggagcttgatgttcctcttggtgaggaa
gttggatatgccatcagatttgaagatagaacctcagaaagaacccgcataaaatacctt
actgatggagttatgcttcgtgaaagcctggcgaatccagagcttaatgaatattcggtt
ataatactagatgaagctcatgaaaggagtctaaacacagacatattgctgggattgatg
aaacgcttggttaaacggcctgcctcaaatttaaaagttctcattacttcagctactctt
gatggtgataaagtatcaaaattcttttcaaattgccctgtaatgactgttccagggaag
ttataccctgttgaaatattgtacagcaaggagcgtcccaaaagctatctggagacatct
ttaaaaacagctcttgatatacatattaaggaaccagaaggtgatgtcttaatatttatg
actggacaggatgatatagagaagttggtttcaaaattagaagagaaaatcagaagcctg
gaggaaggatcttgcatggatgccataatccttccccttcatggttctttgccgcctgaa
atgcaggtacgtgtgtttagccctccgccaccaaactgtaggcgaataattgttgccaca
aacattgctgaaacttctctgactgtggatggtgttgtgtatgttattgattctggttat
gttaagcaaaggcagtacaacccatcaactggcatgtactctcttgatgttgttcaaatt
agcaaagtacaagcaaatcaacgtgcaggtcgagcaggaagaacacgtccagggaagtgc
tatcggctatacccttccacagtttaccatgatgatttcctggatgtaacagttcctgaa
atacagcgatcttcccttgctggaactgttctttatttgaaatcattggacctcgctgat
attgatatcctcaaatttgattttcttgattccccttcatctgagtctttagaagatgct
ttgaagcaattatatctcattgatgctatcgatgaaaatggattgatcacaaaagttggg
cgaacaatggctgagcttccgctagaaccttcgctctccaggaccttaatggcagcaaat
gaatatggttgcttatcccaggctttgactgttgctgctatgttgtctgcagaaaccaca
ttgcttcctggtcgaagcaagaatactgagaagaagaggaaacataatcatgtggacctt
cctgatggatctggctggggggatcatatccagttgctacagatctttgaatgctggcat
cgaactaactatgatattgattggtgcaaggataatggcttgcaggttagagggatgaag
tttgtcaaggatgttcggaaacagttatctcagataatgcagaaaatagcaaaagggcca
ttagatgtagagacaagcagaagatgggaagaaagccaacacaattatctcaatttgagg
aaggctttgtgcacagggtatgctaatcagctagctgagagaatggtgtatcacaatggt
tatcgaacattgggctttaaaccccaagtggtacaggtgcacccatccagtgtactgaaa
ccagatgatgatggaaaacttccagagtatgttttgtatcatgagctcattgcaacctca
cgcccatacttgcgatccgtttgttctgttgatattaaatgggtgacacctattatagag
aaggttaataaactaaatgtcatcaaactgagtggagggataaatcatattgaagaggga
actgagggaattaattcaaacttgccaaagaaagaggtcgttgttgctggggttcctgat
aagcctgacgatagaatacaagcagctagggaacgatttcttgctcgtaagggaaagaaa
tga

DBGET integrated database retrieval system