KEGG   Ziziphus jujuba (Chinese jujube): 107430284Help
Entry
107430284         CDS       T04794                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 1, mitochondrial isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00564  Glycerophospholipid metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107430284
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     107430284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 107430284
NCBI-ProteinID: XP_015896602
Position
11
AA seq 469 aa AA seqDB search
MQNCDPSDSVQTKVLAESVPKLLPHHRKMKFGGSQRFPVFPRPVHRNYLHKQHRCFTSFV
KKFQRATQSRASSNGGSGSSQGHYFLVPGATVATLLMLSVLHARRMYDDKKVEEAREKGI
ESEFQPDIKATYLQLLPLRSISRCWGYLTSMEIPVWLRPHVYRAWARAFHTNLEEVALPL
DGYATLQEFFVRTLKEGCRPLDPDPQCLVSPVDGTILRFGEIKGAGAMIEQVKGFSYSVS
SLLGASSYLPMVAAVDADGETGEPENSSRENSKRSWWRVSLASPKFWDPMSACPMKGLFY
CVIYLKPGDYHRIHSPADWNIVIRRHFSGHLFPVNERAARTIRNLYIENERVVLEGLWPE
GFMAIAAIGATNIGSIKLSIEPELQTNRQRGKLLQAEPPEERLYEPEGIGMTVKKGDEVA
SFHMGSTVVLIFQAPVKNKDSSSEFKFCIQRGDKIRVGEALGRWRDSSN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattgcgatccaagcgactctgtccagacaaaggtccttgctgagagtgtccca
aaactcttaccacatcatagaaagatgaaatttgggggttcacagagattccctgtattt
cctcgccctgtccaccgcaattacctccataagcagcaccgctgcttcacttccttcgtt
aaaaagttccaaagagccacgcaatctcgagcttcttccaatggcggcagtggcagctcc
caaggtcattattttttggtgcctggtgcaactgtggctacgttacttatgctgagtgtt
cttcatgctcgtcgtatgtatgatgacaaaaaagttgaagaggcacgggagaaaggaatt
gaatctgagttccaacctgatataaaagctacttacctacaattgctgcctctacgctcc
atttccagatgttggggttacttgacaagcatggagattcctgtctggctacgtccgcat
gtgtatagagcttgggctcgggcattccatacaaacttggaagaagttgctttgccttta
gatggatatgctactttacaagagttctttgttcgcaccttgaaagaaggttgcaggcct
cttgatcctgacccacaatgtctggttagtccggttgatggtacaatcttaagatttgga
gagataaaaggagcaggagctatgatcgagcaagtcaaagggttttcttattctgtttct
tcacttcttggtgcaagctcataccttcctatggtggctgcagtggatgcagatggagaa
acaggtgaaccagaaaactcttcgagagagaacagtaagaggtcttggtggagagtttca
ctggcttctcctaaattttgggatcctatgtcggcatgtcccatgaaaggtctattttac
tgtgtaatttatttaaagcctggagactatcatcgcatacattcgccagctgattggaat
attgttattcgccggcatttctcaggtcacctatttcctgtgaatgaacgtgctgcaaga
actatcagaaacctttatattgaaaacgaaagggttgtgcttgaaggtctatggccagaa
gggtttatggcaattgctgcaattggtgcaacaaatattggttcaattaagctttcaatt
gaaccagagctccagacaaatcggcaaagagggaagttattgcaggctgagcctccagaa
gaacggttatatgagcctgaaggaattggaatgactgttaagaaaggcgatgaggtagct
tctttccacatgggatcaaccgtggtgctcatctttcaggctccagtgaaaaacaaggat
tcctcgtcagagttcaagttttgtattcaacgaggagacaaaattcgagtcggagaagcc
ttgggaaggtggcgggatagtagcaactaa

DBGET integrated database retrieval system