KEGG   Ziziphus jujuba (Chinese jujube): 107430302Help
Entry
107430302         CDS       T04794                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00052  Galactose metabolism
zju00500  Starch and sucrose metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107430302
   00500 Starch and sucrose metabolism
    107430302
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107430302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107430302
NCBI-ProteinID: XP_015896625
Position
11
AA seq 681 aa AA seqDB search
MVDYQPFLSVHVPDDSVEVVQNSYSSPIDGDRSPVTRRRSVKEILIVFSGLLMVALLVAI
IGGKEPNFHADTNGSLASSRPRPEILRPAVSRGVSEGVSEKTNRLNSAGDNVQEFPWNNS
MLSWQRTAYHFQPENNWMNDPNGPLFYKGWYHFFYQFNPNGAVWGDIVWGHAVSTDLIHW
IHLPLAMIADQWYDINGVWSGSATIVSDDKVVMLYTGLTNESVQVQNLAYPADPSDPLLI
KWVKYSGNPVLFPPSGIDSQDFRDPTTAWLTSEKKWRIIIGSKVNETGISFVYDTEDFKT
YKPLKGVLHGVPGTGMWECVDFFPVSLIENVGLDTSENGLGLKHVVKASLDEDRHDYYAF
GTYDERSGKWVPDHPEIDVGIGLRYDYGIFYASKTFYDQAKKRRVLWGWISESDSESADM
KKGWASLQSIPRTLLFDNKTGTHLLQWPVEETESLRLSSKEFDKVLVKPGSVVPLDVGTA
TQLDIIAEFELDEKALEEVYESNEEFSCSSSGGAAQRGALGPFGILVLADDSRSEQTPVY
FYVSKGSDGYLKTFFCTDQSRSSVATDVNKQIYGSFVPVIQDEKLSVRILVDHSIVESFA
QGGRTCITSRVYPTKAIYGAARVFLFNNATETNVTASLKIWQMNSAFIHPYQNENHIDSS
IKLSNNLVISILFFFLLFFFL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggttgactaccagccattcctttctgtccatgttcccgatgactccgtcgaagtcgtt
caaaactcctacagctctcctattgacggagatcgatccccggttacccgccgacgatcc
gtgaaagagattttgattgtcttttctgggttgttaatggttgctctgttggtggcaatt
attggcgggaaggaacccaattttcatgcagacacaaatggatcattggcctcatcgagg
ccaaggccggagatattgcggccggccgtttcacgcggtgtatcggaaggagtttcggag
aagacgaaccgcttaaactccgccggcgataacgtgcaggaatttccatggaacaatagc
atgttgtcatggcaaagaactgcttaccatttccaaccagaaaacaattggatgaatgat
cctaatggtccattgttctacaaaggttggtaccatttcttctaccaattcaatccaaac
ggtgctgtatggggggacatagtatggggccatgcggtgtccaccgacttgatccactgg
atccacctcccacttgccatgatcgccgatcaatggtacgacatcaacggtgtctggtcc
ggttctgcaaccattgtttccgacgacaaggttgtcatgctttacaccggtttaaccaac
gagtcggtccaagttcaaaaccttgcatatccagctgacccatctgatccactcctgatc
aagtgggtcaaatactccggcaacccggttcttttccctccgtcggggatcgacagccag
gatttccgagaccccacaacggcgtggctgacgtcggagaagaaatggcgtattatcata
ggttccaaggttaacgagactggtatttcctttgtgtatgatacagaggacttcaaaacc
tacaaacctttgaaaggagttcttcatggagtcccaggtaccggaatgtgggagtgtgtt
gatttcttccctgtgtctttgattgagaatgtcggtttggacacgtcggagaatggactg
ggattgaagcatgtggtgaaggctagccttgatgaggatagacatgattactatgctttt
ggcacttatgatgagagaagtggtaaatgggttcctgatcatcctgagattgatgttggg
attggacttaggtatgattatgggattttctatgcttccaagactttctatgatcaagct
aagaagaggagagttttgtggggttggattagtgaatccgacagtgaatctgctgatatg
aagaaaggatgggcttctcttcagagcattccaaggacacttttattcgataacaaaacc
ggcactcatctactccaatggccagtggaagagactgaaagtttgagattgagcagtaag
gaatttgacaaagtattggttaagccagggtcagtggtgccacttgatgttggcacagcc
acacagttggacattattgccgagtttgagctagatgagaaggcattggaggaagtatat
gaatccaatgaagagtttagctgcagcagcagtggtggagctgcacagcgcggcgctttg
ggaccctttggaattctggttcttgcagatgacagccgctctgagcagactcccgtatac
ttctatgtttctaaaggatctgatggctacctcaagaccttcttctgtactgaccaatct
aggtcctctgtggcaactgatgttaacaaacaaatctatggtagctttgttcctgttata
caagatgaaaaactatctgtcaggattttggttgaccattcaatagtggaaagctttgct
caaggtggaagaacttgcatcacatcaagagtttatcccacgaaagcaatctatggcgct
gctcgggtttttctcttcaacaatgcaaccgagacaaatgttactgcttcacttaagatt
tggcagatgaactctgcattcattcacccttatcagaatgagaaccatattgactcatcc
atcaaattgtccaataatcttgttatttctatattatttttcttcctcctgttcttcttt
ttgtaa

DBGET integrated database retrieval system