KEGG   Ziziphus jujuba (Chinese jujube): 107430317Help
Entry
107430317         CDS       T04794                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00071  Fatty acid degradation
zju00410  beta-Alanine metabolism
zju00592  alpha-Linolenic acid metabolism
zju00640  Propanoate metabolism
zju01040  Biosynthesis of unsaturated fatty acids
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
zju01212  Fatty acid metabolism
zju04146  Peroxisome
Module
zju_M00087  beta-Oxidation
zju_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107430317
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107430317
   00592 alpha-Linolenic acid metabolism
    107430317
   01040 Biosynthesis of unsaturated fatty acids
    107430317
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107430317
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107430317
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107430317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 107430317
NCBI-ProteinID: XP_015896641
Position
11
AA seq 438 aa AA seqDB search
MEGGDHLASERKKANFDVDEMKIVWAGSRHAFEISDRIARLVASDLAFRKDNRTMLSRKE
LFKNTLRKAAYAWKRIIELRLTEEEASKLRFYVDEPAFTDLHWGMFVPAIKGQGTEEQQQ
KWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPQTDEFIINSPTLTSSKWWPGGLG
KVSTHAVVYARLITDGQDHGVHGNYCYSEISFTMARVSRVTREGKYVHSNVPRQLVYGTM
VFVRQTIVSDASCALSRAVCIATRYSAVRRQFGSQKGGVETQVIDYKTQQSRLFPLLASA
YAFRFVGEWLKWLYTDVTERLQANDFSTLPEAHACTAGLKSLTTSATADAIEECRKLCGG
HGYLCSSGLPELFAVYVPACTYEGDNIVLLLQVARFLMKTVSQLGSDKKPVGTTAYFLRV
EHLMQCSSIAQKGLVQCF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggagatcatttagccagcgaaaggaagaaggcaaacttcgatgttgacgag
atgaagatcgtctgggccggttctcgtcacgcttttgagatctccgatcggattgctcga
ctcgtcgccagcgatctggcatttcgaaaggataatagaaccatgttaagtagaaaagag
ttgtttaaaaacacattgagaaaagcagcttatgcctggaaacggattatagagcttaga
cttactgaagaagaggcatcaaagttgaggttttatgtggatgaacctgctttcacagat
cttcactggggaatgtttgtgcctgctattaaaggacaaggtactgaagagcagcaacag
aaatggctacccttggcttataagatgcagataatcggttgctatgcacaaactgaactt
ggacatggttccaatgttcaagggcttgaaaccactgcaacttttgacccccagacggac
gagttcattattaatagccccacgctgacttcaagcaaatggtggcccggtggattgggt
aaagtttccactcatgctgttgtttatgctcgccttattactgatggtcaggatcatgga
gtccacggtaattattgctattctgaaatttctttcacaatggccagggtttctcgagtt
acaagagaagggaaatatgtgcattccaatgttccacggcagctagtttatggaaccatg
gtatttgtgagacaaacaattgtatctgatgcctcctgtgctctgtcacgggcagtttgc
attgccacaaggtatagtgctgttcgtagacaatttggttcacagaaaggaggtgttgag
acccaggtgattgattacaaaactcagcagagtaggctcttccctttgctggcttctgcc
tatgctttcagatttgttggtgagtggttaaaatggttgtatacggatgtgaccgaaaga
ttgcaagccaatgatttctcgacattgcctgaggctcatgcatgcactgcgggtttaaag
tctttaactacttcagcaaccgctgatgcaattgaagaatgccggaaattatgtggtggg
catggttacttatgtagcagtggacttcctgagttatttgcagtttatgttcctgcttgt
acttatgaaggggataatattgtgctacttttacaggttgcaaggtttcttatgaagact
gtatctcagctggggtctgataaaaaacctgttggaaccacagcttattttctgcgagtg
gaacatttgatgcagtgtagttcaattgctcaaaaaggtttagttcaatgtttctaa

DBGET integrated database retrieval system