KEGG   Ziziphus jujuba (Chinese jujube): 107430892Help
Entry
107430892         CDS       T04794                                 

Definition
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00010  Glycolysis / Gluconeogenesis
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107430892
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     107430892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 107430892
NCBI-ProteinID: XP_015897253
Position
11
AA seq 605 aa AA seqDB search
MDTKIGALDACKPANNDVGCLPNDFVTTIQNSVPSSVINSSDATLGRHLARRLVQIGVTD
VFTVPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV
LNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCFQAVVNN
LEDAHELIDTAISTSLKESKPVYISISCNLAGIPHPTFSREPVPFVLSPKLSNHMGLEAA
VEATAEFLNKAVKPVMVGGPKLRVAHATDAFVELANACGYPVSVMPSAKGLVPEHHPHFI
GTYWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIILQPDRVTIANGP
TFGCILMKDFLKALAKRLKHNNTAYENYHRIFVPDGHPLKAAPNEPLRVNVLFQHIQNML
SSETAVIAETGDSWFNCQKLKLPQGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFI
GDGSFQVTAQDISTMLTCGQRTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHN
GEGKCWTTKVRTEEQLIEAIATATGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaagattggagcgctcgacgcgtgcaagcctgcaaacaacgatgtgggttgt
cttccaaatgactttgtgactaccatccagaactcggtcccttcctccgtgatcaactca
tccgacgcaactctgggtcgtcacctcgctcgccggcttgttcaaatcggcgtcaccgat
gtgttcaccgttcccggtgacttcaacttgaccctccttgaccacctcatcgccgagccg
gggcttaataatattggctgctgtaacgagcttaatgccgggtatgctgctgatggctac
gcgaggtcacgtggcgtcggtgcttgtgtcgtcacgttcaccgtcggcgggcttagtgtt
ctcaatgccatcgctggtgcgtacagtgagaacttgcctttgatttgcatcgttggtggt
ccaaactccaacgactatggaactaacagaatcctccatcatacaattggattacctgat
tttagccaggagcttaggtgctttcaaactgtcacatgctttcaggctgtggtgaataat
ctggaagatgcacatgaattgatcgatacggccatttcaacatctttgaaggaaagcaag
cctgtatatatcagcataagctgtaacttggctggaattcctcatccgactttcagccga
gagccagttccatttgttctgtctcccaaattgagtaatcacatgggattagaagcagca
gtggaggccacagcagagttcttgaacaaggcagtgaagccagtcatggtaggtggtcct
aaactgcgagttgcccatgccactgatgcttttgtggaactagccaatgcctgtggctac
ccggtctccgtgatgccatcggcgaaagggctcgtgccagagcaccacccgcatttcatt
ggaacttactggggtgctgtgagcactgccttctgtgcagagatcgtggaatcggccgat
gcatatctgtttgctgggcccattttcaatgactatagctctgttgggtattcattgctt
ctgaagaaagaaaaagcgatcatcttgcagcctgaccgtgtgacaattgccaatggtcca
acgtttggttgcattctgatgaaggatttcctgaaagcacttgcaaagaggctcaaacat
aataacactgcttatgaaaactaccataggatctttgtcccagatggacatcctctcaag
gctgcacctaatgagcctttgagggttaatgttctctttcaacatattcagaatatgctt
tcaagtgaaactgctgtgattgctgaaacaggggactcatggtttaactgccagaagctc
aaattgccacagggttgtggctatgaattccaaatgcaatacgggtcgatcggttggtcg
gttggagcaactcttgggtatgctcaggctgtccctgagaaacgagttcttgcttttatt
ggagatggaagcttccaggtgactgctcaagatatttcaaccatgctgacgtgtggacag
aggaccatcattttcctgataaacaatgggggatacaccattgaagtggagatccatgat
gggccttacaacgtgatcaagaactggaactacactggcctggtcgatgccattcataat
ggagaaggaaaatgctggacaactaaggtccgtaccgaggagcaactgatcgaagccata
gcaacagcaacaggacctaagaaagattcattgtgtttcattgaggtgattgttcacaag
gatgataccagcaaagagctgcttgaatggggctcgagggtctctgctgctaatagccgc
ccacccaatcctcagtag

DBGET integrated database retrieval system