KEGG   Ziziphus jujuba (Chinese jujube): 107432135
Entry
107432135         CDS       T04794                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00100  Steroid biosynthesis
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107432135
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107432135
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 107432135
NCBI-ProteinID: XP_015898689
UniProt: A0A6P4AT32
Position
12
AA seq 471 aa
MRKVAVRTVGQLKSHFEYFIIFNISLPSLRGSQIFVLGLKTKGPFIGNRLRDGIKRSSRD
EAQDINSVKINQFKIRRNSGGWRPREWQLQTVVVSERVSLMEMDLGFILQGLIPSWNSVA
MLCGFFLYLAIVGSILPGQVVPGVILPDGTRLHYRCNGLVLLILLVALLGIAAKMDMISL
TAISDRGLELLSTTFLFSFLATLVLFAAGCKSNNRGSSLKPHVTGNLIHDWWFGIQLNPQ
FLGIDLKFFFVRAGMMGWLLINLSVLARSVQDATINRSMILYQLFCVLYILDYFVHEEYM
TSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELTTAAVIANCFVFMIGYLVF
RGANKQKHVFKKNPKAPIWGKPPKVVGGKLLASGYWGIARHCNYLGDLLLALSFSLPCGI
SSPVPYFYPLYLLILLIWRERRDEARCAEKYKDIWAEYRRLVPWRILPYVY
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgcgaaaggttgcagtacggacagtagggcaattaaaaagccacttcgaatattttatt
atatttaatatttctctgccctctctgcgaggcagtcaaatatttgttttagggttgaaa
acgaagggaccttttatagggaatagactgagagatgggattaagcggagcagcagagat
gaagcgcaggacataaatagtgtcaaaataaaccagtttaaaatacggagaaactcaggc
gggtggcgtccaagagagtggcagctacagactgtagtagtgagtgagcgagtgagtctg
atggagatggatctgggttttatccttcaaggcctaattccttcatggaactctgttgct
atgctatgtggattctttttatacttggcaattgtaggatctatacttccgggccaagtt
gttcccggtgtcattttaccagatggaacccgtcttcactatcgctgcaatggtttggta
ttacttattctgctggtggcgcttcttgggattgctgctaagatggatatgatatcgctg
actgcaatatcagatagagggcttgagctgctatcaacaacttttttgtttagttttctg
gccacattggtactttttgctgctggctgtaagtcaaacaatcgtggttcctccttgaag
cctcatgtgacagggaacctaatacatgactggtggtttggaatacagctgaatcctcag
tttctgggcattgacctcaaatttttctttgttagagctggaatgatgggctggctactt
atcaatctatcagttctggctagaagtgttcaagatgctaccattaatagatcaatgatc
ttatatcagttattttgtgtgttgtacatacttgactattttgttcatgaggagtacatg
acctccacgtgggacataattgctgagagattaggcttcatgctggtatttggagaccta
gtctggattcctttcacttttagcatccagggttggtggcttttgagcaacaaggtggaa
ttgacaacagctgctgtcatagcaaattgctttgtttttatgattggatatcttgtattt
agaggagctaacaagcaaaagcatgtgtttaaaaagaatccaaaagcaccaatatggggt
aagcctcccaaggtcgttggtggaaagttgcttgcttctggttactggggaattgcgagg
cactgtaattacctcggagacttgttgcttgcattgtcgtttagtttgccttgtggaata
agttccccagttccatacttctacccactttaccttctaatcctacttatatggagagaa
agaagagatgaagctcgctgcgcagagaaatacaaagacatttgggcagaataccgtaga
ctagtcccatggagaatattaccttatgtttattag

DBGET integrated database retrieval system