KEGG   Ziziphus jujuba (Chinese jujube): 107432776Help
Entry
107432776         CDS       T04794                                 

Definition
(RefSeq) glutathione hydrolase 3-like isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00430  Taurine and hypotaurine metabolism
zju00460  Cyanoamino acid metabolism
zju00480  Glutathione metabolism
zju00590  Arachidonic acid metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107432776
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    107432776
   00460 Cyanoamino acid metabolism
    107432776
   00480 Glutathione metabolism
    107432776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:zju01002]
    107432776
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:zju04090]
    107432776
Enzymes [BR:zju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     107432776
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     107432776
    3.4.19.14  leukotriene-C4 hydrolase
     107432776
Peptidases and inhibitors [BR:zju01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   107432776
CD molecules [BR:zju04090]
 Proteins
  107432776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 107432776
NCBI-ProteinID: XP_024922627
Position
12
AA seq 499 aa AA seqDB search
MIVRSSSNSKTEAFDSRETAPLAASENMYADNPKAKLEGALSMGVPGEIAGLYEAWLKYG
RLSWRNLFQPAIKFAKDGFIVAPYLGQNIMDESEKILNDPGLRQVYAPKGKLLQVGDICY
SVELGHILEEIAQLEPKAFYNGTVGEKFVKDVREAGGILTMGDLRNYRVEVTDTMAADVM
GYTIYGMPPPSSGTLGLTMVMNILDGYGNPDAAKGSLGLHRLIEAMKHMFAIRMNLGDPH
FVNISTFVSDMLSPDLAKKIRDKIFDNTTFPPEYYMWSQLRDYGTSHLCIVDTDQNAVSM
TTTVNYPFGGRVLSTSTGIVLNNEMGDFSIPTEMTVDGLPPAPNFIRPYRSPLSSMTPLI
VTKDNHLAGVLGGSGGMKIMPAVAQVFLSHFFLGMDPLSAVNNPRVYHQLIPNVVLYENF
TVFNGNHIEVSDETKLFLQERGHQVETPSRSAITQLVVQSLGNPIKMDQISGKVSNAQIF
HGTLTAVRDPRKDGKPAAI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcgatcttcatcgaactccaaaactgaagcttttgactcgagagaaacagct
cctttggctgcttcagagaatatgtatgccgacaatcctaaagccaagctagaaggtgca
ctatcaatgggagttcctggtgagatagctggtctctatgaagcctggttgaaatatggg
cgtttgtcatggaggaatttgttccaacctgcaataaaatttgccaaagatggatttata
gttgctccttatctcggacaaaacataatggacgaatcagagaagattttgaatgatcct
ggtttaagacaagtgtatgcaccaaaaggcaaattgttgcaggtgggtgatatatgctac
agcgtggaacttggccatattttagaggaaattgcacaattggaaccaaaagccttctac
aatggtacagttggtgaaaaatttgttaaggatgtgagagaggctggtgggattttgacc
atgggggatttaagaaattacagagtggaagtaactgatacaatggctgcagatgtgatg
ggctacaccatatatggaatgcctcctccttcaagtggaactttggggctcactatggtt
atgaacatcttggatggttatggaaatcctgatgctgcaaagggaagtcttggtctgcat
cgactaattgaagcaatgaaacacatgttcgccatccgaatgaacttgggagaccctcat
tttgtgaacattagtacttttgtatctgacatgctttccccagatttggcaaagaaaatc
cgcgataagatatttgacaatacaactttccctccggaatactacatgtggagtcagcta
agagattatggaaccagccatctctgcattgtcgatacagatcaaaatgctgtgtcaatg
acaaccacagtaaattatccttttggtggaagggtgctttctacttctacagggattgtg
ctcaacaatgagatgggtgacttctctattcccaccgagatgacagtggacggtttacct
cctgctccaaattttatcagaccatacaggagccctttatcgtccatgaccccactaatt
gtcacaaaggataatcatttagcaggggttcttggaggtagtggtggtatgaagataatg
ccagcagttgcccaggttttccttagccattttttcttggggatggaccccttaagtgca
gtaaataatccaagggtctaccaccagctaattcctaatgtggtgttgtatgaaaacttc
acggtgttcaatggcaatcacatcgaggtttcagacgaaacaaaactgttcttgcaagag
aggggtcatcaagttgaaactccgtcaaggagtgctatcactcagcttgttgttcaaagt
cttggaaaccccattaaaatggaccaaatcagtggaaaagtttctaatgcacaaatattt
catggtacactcactgctgtaagagaccctagaaaggacggtaagcctgctgcaatttga

DBGET integrated database retrieval system