KEGG   Ziziphus jujuba (Chinese jujube): 112491783Help
Entry
112491783         CDS       T04794                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zju01001]
    112491783
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112491783
Protein kinases [BR:zju01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112491783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH TetR_C_9
Motif
Other DBs
NCBI-GeneID: 112491783
NCBI-ProteinID: XP_024930000
Position
5
AA seq 355 aa AA seqDB search
MGNRSHRRRVRWLVAEIFGEFSRSKGEGLNSTSSDKNGGRNVEISAVEGIDAATKKSPDP
SASPVGWDVTQNFINEVLTVGRIHHVNVVQLVGFYVKGSKRALVYDFMPNGSLDKYLFSQ
EGITSLDCKTMCQISYGIACGIEYLHRGCSMQILHFDIKPHNILLDENFIPKISDFGLVR
LSPLDNNIVSLTGAKGTMRYIAPELFYKNVGGVSNKADVYSFRMLLMEMTSRRKNLNVAA
EHTCQIYFPSWVYDQLKDGNDFEMGDETEEESRIRKKMIIVSLWCIQMNPSDRPTMNKVK
EMLEGEVESLQMPPKPFVCPQVEPVNDEGLKSNSRCSAPASNDDSEEITEIIESC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgtagccatcgacggcgcgtacggtggctggtggctgagatttttggggag
tttagtagatcgaagggagagggtctcaacagtaccagcagtgacaagaatggaggccgg
aatgtggagatctcagcggttgaaggaatcgacgccgccaccaaaaaaagccccgatccg
agcgcgtcgccagtcggatgggatgttacacaaaacttcatcaatgaagtcttaactgtt
ggaaggattcaccatgttaatgtggtgcaacttgttggtttttatgtcaagggatcaaag
cgtgctcttgtttatgattttatgcctaatggatctcttgataaatatcttttttctcaa
gaaggaattacctccttagattgcaagacaatgtgtcaaatttcatatggaatagcttgt
ggtatcgaatatcttcatcgaggatgcagcatgcaaattctgcattttgacattaagcca
cacaacattcttttggatgagaattttattccaaagatttctgatttcgggcttgtgaga
ctatccccgttagacaataacattgtctctcttactggagcaaagggaaccatgcgatac
atagctccggagttgttctacaaaaacgttggaggagtttctaacaaagcggatgtttat
agttttagaatgctattgatggaaatgaccagtagaagaaagaatttgaatgtagctgca
gagcatacatgtcaaatttactttccgtcatgggtttatgatcaacttaaagatggaaat
gactttgaaatgggagatgaaacagaggaagaatcaagaataagaaagaagatgattata
gtatcattgtggtgtatacaaatgaatccaagtgatcgtccaacaatgaacaaagtcaaa
gagatgcttgaaggagaagttgaaagtttacaaatgcctccaaagccttttgtgtgccca
caagtagagcctgtaaatgatgaagggctgaaatcaaattcaaggtgctcagcaccagcc
tcaaatgatgattccgaagagattactgagattatagaatcatgttaa

DBGET integrated database retrieval system