KEGG   Ziziphus jujuba (Chinese jujube): 112491847Help
Entry
112491847         CDS       T04794                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zju01001]
    112491847
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112491847
Protein kinases [BR:zju01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112491847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 112491847
NCBI-ProteinID: XP_024930160
Position
5
AA seq 421 aa AA seqDB search
MKSMAPWFPNLVVRLPDQFLLLFIIILLFLCSSTTCFAISGEAEALVKWKDSLDMNPTTH
SLLRSWNLNSTVSTSHRLYNNTPCNWVGITCNGFGSVINITLYSSNLKAWNHDGKKVHEE
IVEATENFDSKYCIGVRGNGSVYKTLLSTGQLVAVKKFHENDGIDHQQAFKSETSILPKV
RHRNIIKLFGFCSHTRYSFLVYEFMELGSLVKILSDNEKATELEWFKRVNIVKGLAKATS
YLHHECFPAIVHRDISSKNVLLDDECEAHISDFGSATTLDPVSSNWTPFAGTLGYSAPEL
AYTMEVNEKIDVYSFGVVALESIMGEHPGDLISSLLSSPLHAVDVLLKDVLDQRLSPPKR
QIADQVVSIAEIAFACVRQSPQSRPTMKQVSQKLSTPLQSLSVPFHMVTIKQLFDSPTWT
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatggcaccctggtttccaaacctcgttgtacggttacctgatcagtttttg
ttgttgtttatcatcatcctactatttctttgttcttctactacttgttttgcaataagt
ggagaggcagaggctcttgtgaaatggaaggacagccttgatatgaatccaactactcat
tctcttctccgctcttggaatctcaattctactgtttcaacttctcaccgtctttataat
aataccccctgtaactgggttgggatcacttgtaacggctttggcagtgtcatcaacatt
actctttacagcagtaatctgaaagcatggaaccatgatgggaaaaaagttcatgaagaa
atagttgaagcaacagagaattttgattccaaatattgcattggagttagagggaatggt
agtgtgtataaaacactactatcaactggtcaacttgttgctgtgaaaaagttccatgag
aatgatggaatagaccatcaacaagctttcaaaagcgagacaagtattttgccaaaagtg
cgccatcgaaatatcatcaagctttttggattttgttcgcatacaagatactcatttttg
gtgtatgagttcatggaactgggaagtttggtaaagatattgagcgacaatgaaaaggca
acagagttggaatggttcaagagagtgaatattgtcaaaggtttggcaaaggcgacatcc
tatctgcaccatgaatgttttccagctatagtccacagagacatatctagtaagaatgtt
ctgttggatgatgaatgtgaagctcacatttctgacttcggctctgctacaactttagat
ccagtctcatcaaattggactccatttgcaggaaccttaggttactcagccccagagctt
gcttatacaatggaagtaaatgagaagattgatgtctacagcttcggagttgttgcatta
gaatctatcatgggagagcatcccggagacctcatatcatctctgttatcatcaccatta
catgctgttgatgttctgcttaaggatgtacttgaccaacgtctctcacctccaaagcgg
caaatagcagaccaagtggtctccattgcagaaatagcatttgcttgcgtgcgacaaagt
ccacagtcacgaccaactatgaagcaagtatctcagaagctgtcgactccattacaatca
ttatcagtgccttttcatatggttacaataaagcagctgtttgattccccaacatggaca
tcctaa

DBGET integrated database retrieval system