KEGG   Zea mays (maize): 100191578Help
Entry
100191578         CDS       T01088                                 

Gene name
CBL1
Definition
(RefSeq) calcineurin B-like protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
zma  Zea mays (maize)
Brite
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100191578 (CBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 EF-hand_4 EF-hand_9 SPARC_Ca_bdg DUF3368
Motif
Other DBs
NCBI-GeneID: 100191578
NCBI-ProteinID: NP_001130480
UniProt: B4F9B4
Position
1
AA seq 213 aa AA seqDB search
MGCFHSTAKRQHPGYEDPVHLASQTAFSVSEVEALFELFKSISGSVIDDGLINKEEFQLA
LFKNQRKENLFANRIFDLFDVKKRGVIDFGDFVRALNVFHPNIPMEEKVDFSFKLYDMDG
TGFIERKEVKQMLIALLGESEMRLSDEIIETILDKTFSDADANQDGKIDRTEWENFVTRN
PSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcttccattccacggcgaagcggcaacaccctggctacgaggaccccgtgcac
ctcgcctcccagaccgccttcagcgttagtgaggttgaggctctattcgagctgttcaag
agcataagtggttcggtgattgatgatggcctgatcaacaaggaagaattccagctagca
ctatttaagaatcagaggaaagaaaatcttttcgccaatcggatatttgaccttttcgat
gtcaagaaaaggggtgtcattgattttggtgactttgtccgagctctaaatgtgtttcat
ccaaatatcccaatggaagaaaaagtcgatttctcgttcaagctatacgatatggatggc
acagggtttattgaacgaaaggaggttaagcagatgttaattgctctcctaggagaatca
gaaatgaggctatctgatgagatcattgagacaatcctggataagacattttcagatgct
gatgcaaatcaggatggaaaaatagatagaacagagtgggagaattttgtcacaagaaat
ccttccttgatgaagataatgactctgccatacctcaaggacataacaacaacattccct
agctttgtgtttaactcggaagtcgacgatctcgtcacgtga

DBGET integrated database retrieval system