KEGG   Zea mays (maize): 100191671Help
Entry
100191671         CDS       T01088                                 

Gene name
AY109534
Definition
(RefSeq) uncharacterized protein LOC100191671
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00260  Glycine, serine and threonine metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
zma01230  Biosynthesis of amino acids
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zma_M00002  Glycolysis, core module involving three-carbon compounds
zma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100191671 (AY109534)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100191671 (AY109534)
Enzymes [BR:zma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100191671 (AY109534)
Membrane trafficking [BR:zma04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100191671 (AY109534)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100191671 (AY109534)
  Exosomal proteins of melanoma cells
   100191671 (AY109534)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100191671
NCBI-ProteinID: NP_001130572
UniProt: B4F9Q0
Position
4
AA seq 167 aa AA seqDB search
MWSQIYSEETKKQSIPVITAWQLNERMYGELQGLNKQETADRFGKEQVHEWRRSYDIPPP
NGESLEMCAERAVAYFKDQIIPKLVDGKHVMIAAHGNSLRSIIMHLDKLTSQEVISLELS
TGIPMLYIFKEGKFIRRGSPAGPSEAGVYAYTKNLAQYRQKLDGIVQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtcagatatacagtgaagagacaaagaagcagtccattcctgtcataacagct
tggcaattgaatgaacggatgtatggtgagcttcaaggccttaacaaacaagaaactgcc
gatcgatttggtaaagaacaagttcatgaatggcgtcgcagttatgatattcctccccca
aatggcgagagccttgagatgtgtgcagagagagcagttgcttatttcaaagaccaaatt
atacctaaacttgtggatggaaagcatgtaatgatcgctgcccatgggaattcacttcgt
tcaatcataatgcatttggacaagctgacttctcaagaggttatcagccttgagttgtct
actggcattcctatgctgtatatatttaaggaagggaaattcatcaggcgaggaagcccc
gctggaccttctgaagcaggtgtctatgcttataccaagaatttggctcagtacagacag
aagcttgatggcatagttcagtag

DBGET integrated database retrieval system