KEGG   Zea mays (maize): 100193019Help
Entry
100193019         CDS       T01088                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100193019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 PrmA Methyltransf_11 Methyltransf_32 MTS Fibrillarin GCD14 CMAS Sld5
Motif
Other DBs
NCBI-GeneID: 100193019
NCBI-ProteinID: NP_001131659
UniProt: B4FDI2
Position
2
AA seq 280 aa AA seqDB search
MCLAAACASATLARRLSPSTALPRRFLLGAPTRPSPPPPLLRRCLPFHFYHMAQYWTQPS
LDRNKAMVEYLKQYGAVRTDKVKEVMETIDRALFVPEGTPYIDSPMPIGFNATISAPHMH
ATCLELLKDHLQPGMHALDVGSGSGYLTACFAMMVGPEGRAVGIEHVPEIVASSVENVQR
SAAAPLLRDGSLSFHVTDGRLGFPDAAPYDAIHVGAAAPEIPQPLLDQLKPGGRMVIPVG
TYSQDLQVVDKNTDGSFSVRSDAAVRYVPLTSRAAQLQGP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctcgccgccgcgtgcgcgtccgccaccctagcccgccgcctctcgccctccacc
gcgctcccgcgccgcttcctcctcggcgcccccacgaggccttccccgccaccgcctctg
ctgcggcgctgcctcccgttccacttctaccatatggcgcaatattggactcaaccatca
ctggacaggaacaaagctatggttgagtacctaaagcagtatggtgctgttagaactgat
aaagtgaaggaagtaatggaaacgattgatagagcactatttgtaccagagggtacccct
tacattgacagtcctatgcctattggtttcaacgcgacgatatctgctcctcacatgcat
gcgacctgcttagagctattgaaggatcatttgcaaccaggaatgcatgctctggatgtc
ggatcaggtagtggctacctgacagcttgttttgccatgatggttggaccagaaggccgt
gcagtgggaattgaacacgttcccgagatcgttgcttcttctgttgaaaatgtgcagaga
agtgctgcagctccactactgagggatggatcgctctcttttcatgttacagatggcagg
cttggctttccagacgcggcaccctacgacgctatccatgttggtgcagcggcacctgag
atccctcagcctctgcttgatcagctaaagcctggcggccggatggtgataccggttggc
acctactcccaggacctgcaggtggtggacaagaacacggatggatcattcagcgtccgg
agcgacgcggctgtgcgctacgtcccactgaccagccgcgccgcgcagttgcagggcccc
taa

DBGET integrated database retrieval system