KEGG   Zea mays (maize): 100272353Help
Entry
100272353         CDS       T01088                                 

Gene name
gpm443
Definition
(RefSeq) uncharacterized protein LOC100272353
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
zma  Zea mays (maize)
Pathway
zma04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:zma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    100272353 (gpm443)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zma01001]
    100272353 (gpm443)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100272353 (gpm443)
Protein kinases [BR:zma01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100272353 (gpm443)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 100272353
NCBI-ProteinID: NP_001140308
UniProt: B4FN55 C1IBX9
Position
1
AA seq 376 aa AA seqDB search
MSSAGGMDGSPPVAEFQPTVTHGGRFLRYNIFGNLFEITRKYQPPVMPIGRGAYGIVRSV
MNFETREMVAIKKIANAFDNHMDAKRTLREIKLMRHLDHENIIGIRDVIPPPIPRAFNDV
YIGMEFMETDLHQIIRSGQELSEEHCQYFLYQILRGLKYIHSAGVIHRDLKPSNLLLSAN
CDLKICDFGLARPSSDSDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELIDR
RPLFPGRDHMHQMRLITEVIGTPTDDELGFTRNEDARKYMRHLPQFPRRPFASLFPRVQP
LALDLIERMLTFNPLQRITVAEALAHPYLERLHDVDDEPVCTEPFSFDFERQALTEDQMK
QLIFNEAIELNPSFRY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgccggaggcatggacgggtctccgccggtcgccgagttccagccgacggtg
acgcacggcggccggttcctccggtacaacatcttcggcaacctgttcgagatcacgcgc
aagtaccagcctcccgtcatgcccatcggccgcggcgcctacgggatcgtccgctcggtg
atgaacttcgagacgagggagatggtggccatcaagaagatcgccaacgccttcgacaac
cacatggacgccaagcgcacgctccgggagatcaagctgatgcggcacctcgaccacgag
aacatcatcggcatcagggacgtgatcccgccgccgatcccgcgggcgttcaacgacgtg
tacatcggcatggagttcatggagacggacctccaccagatcatccgctccgggcaggag
ctgtcggaggagcactgccagtacttcctgtaccagatcctgcgcgggctcaagtacatc
cactccgccggcgtgatccaccgcgacctcaagcccagcaacctgctgctcagcgccaac
tgcgacctcaagatctgcgacttcgggctggcgcgcccgtcctccgacagcgacatgatg
acggagtacgtggtgacgcggtggtaccgcgcgcccgagctgctgctcaactccaccgac
tactcggcggccatcgacgtctggtccgtcggctgcatcttcatggagctcatcgaccgc
cgcccgctcttccccggccgcgaccacatgcaccagatgcgcctcataaccgaggtgatc
ggaacgccgacggacgacgagctcgggttcacccggaacgaggacgcgcggaagtacatg
cgccacctcccgcagttcccgcgccggccgttcgcgagcctgttcccccgggtgcagccc
ctcgcgctggacctcatcgagcgcatgctcaccttcaacccgctgcagaggatcacagtt
gcggaggcgctggcgcacccgtacctggagcggctacacgacgtcgacgacgagcccgtc
tgcacggagccgttctcgttcgacttcgagcggcaggctctgacagaagaccagatgaag
cagctgatattcaacgaggccatcgagctgaaccccagtttccgatattag

DBGET integrated database retrieval system