KEGG   Zea mays (maize): 100272357Help
Entry
100272357         CDS       T01088                                 

Definition
(RefSeq) putative alcohol dehydrogenase superfamily protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00071  Fatty acid degradation
zma00350  Tyrosine metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100272357
  Lipid metabolism
   00071 Fatty acid degradation
    100272357
  Amino acid metabolism
   00350 Tyrosine metabolism
    100272357
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100272357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C UDPG_MGDP_dh_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 100272357
NCBI-ProteinID: NP_001140312
UniProt: B4FN61
Position
1
AA seq 403 aa AA seqDB search
MAAAHYGNGSSTSGGGGGRGRGKPITCKAAVAWGPGVPLSLEEVEVAPPSPMEVRVKVLF
TSICHTDLSAWKGECEAQRKYPRILGHEAAGVVESVGEGVEGLAPGDHVVPIFTGECEKC
VYCKSDKTNLCGTYRVDPLKSSMVYDDGTRFSVVDQASGQRRPVYHFLNTSTFTEYTVLD
AACAVKINPEAPLQRMCLLSCGISTGVGAAWNTANVSARSTVAVFGLGAVGLAVAEGARL
RGATRIIGVDVNPSKFTKGKEMGITDFIDPNDICDKPVHEVIREMTDGGVDYSFECTGIN
DVLREAFLSTHDGWGLTVVLGIHSTPKMVPLHPMELYGRRITGCVFGDFKGKSQLPDLVD
KCVNGEVNINFDGFITHKMPFSYINKAFRLLEEGKSLRCLLSL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcccactacggcaacggcagctcgacgagcggcggcggcggcggccgtggc
cgcgggaagcccatcacatgcaaagcggcggtggcgtggggtcccggagtgccgctgtcg
ctggaggaggtcgaggtggcgccgcctagccccatggaggtccgcgtcaaggtgcttttc
acctccatctgccacaccgacctcagcgcctggaagggagagtgcgaggcgcagcgcaaa
taccctcgcatcttgggccatgaggcagccggagtggtagagagcgtgggcgaaggagta
gaaggcctcgccccaggagaccacgtcgttccgatcttcaccggggagtgcgagaaatgc
gtgtactgcaagtccgacaagacaaacctgtgtggaacctaccgtgtggatcctttgaag
agcagcatggtctacgacgacggcacgaggttctccgtggtggaccaggcgtcaggccag
cggcggccggtgtaccacttcctcaacacctccaccttcaccgagtacaccgtgcttgac
gcggcatgtgccgtcaaaatcaaccctgaggccccgctgcagaggatgtgcctcctcagc
tgcggcatctccacaggagtgggagctgcgtggaacactgcaaacgtttctgctcggtcc
accgttgcagtgtttggactcggcgctgttggtcttgctgtagctgaaggtgccaggcta
cgaggggcaactcggatcatcggcgtggacgtaaacccttcaaagttcaccaaaggtaaa
gagatggggataacagacttcatcgaccctaacgacatctgtgacaaaccggtccatgag
gtgatcagggagatgactgacggaggtgtcgactacagcttcgagtgtaccgggataaat
gatgtgctgagagaggccttcttgtccacgcatgatggttggggcctgacggtggtgcta
gggatccattcaacgcccaagatggtgccgctgcacccgatggagctctacggccgtagg
atcaccggctgcgtctttggcgacttcaagggcaagtcccagctgcccgacctcgtcgat
aagtgcgtcaacggggaggtcaatataaacttcgatggcttcataacacacaagatgcca
ttctcgtacatcaacaaggctttccggttactcgaggaaggcaagtcgctgaggtgcctg
ctcagtctctga

DBGET integrated database retrieval system