KEGG   Zea mays (maize): 100272597Help
Entry
100272597         CDS       T01088                                 

Gene name
IDP2408
Definition
(RefSeq) uncharacterized protein LOC100272597 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zma01001]
    100272597 (IDP2408)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RPW8 Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 100272597
NCBI-ProteinID: XP_008676748
Position
4
AA seq 510 aa AA seqDB search
MALWNGIGQVASIAQLAGVDAYGLISMIVEAAKTVKRNRETCQLLARRARMIGDLLHQLE
RTQLMQHMETRNPVEHLEETLRHAYVLITSCRNSSYLYNCCMGGKQADRLREVQNEITFY
LQLFPLVSFVDNTRTWERLLSRACPLCTTENMDELHAAAHHVEHEDGIRSEAIKATKFEN
LGSHPTLKPDIDQMEGQVMRMGGLVNLIGGTKGAELSCFTFSHILAATDNFSEKNLVGKG
GFGYVYKGNLINGLNVAIKRFDACSSYQGPHEFRTEIDAIPNLRHKNIIGLLGYCVQGEE
SILVYEYMSNKCLASVIADETKRGLLNWSKRLQIIKGIADGLAFLHGHSQMCIVHRDIKP
SNILLDHEMNAKITDFGLALMLAPKSTAEVPVLGTYGYADPEYIVTGKISEKADIYGFGI
VLFEIISGRSIHSYMKAEGTRELPYPAYAHKYNPKTLHKLVDPLLRVDEHERAQIMECVR
VAQLCVDHRAKHRPVMSEVVTMLGMAASKG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcactctggaacggcataggtcaggtggcaagcatcgcacagttagccggggtcgat
gcctatgggctcatctccatgatcgtggaggctgcaaagacggtgaagaggaaccgggag
acctgccagctactggcacgccgtgcaaggatgattggggaccttctacatcagcttgaa
aggacacagctgatgcagcacatggagacgaggaacccagtggagcatctggaggagacg
cttcggcatgcgtatgtcctcatcacatcctgtcgcaacagcagctacctatacaactgc
tgtatgggagggaagcaggctgatcggcttcgagaggtgcagaatgagattaccttctac
ctccaacttttcccccttgtcagctttgtcgacaacacccgtacttgggagcggcttctg
agtagagcttgtcctctgtgcacaacagaaaacatggatgagttacatgcagcagcacat
catgtggaacatgaagatgggatcagatcagaggccatcaaggcaactaaattcgaaaat
ctcggaagtcatcctaccctaaaacctgacatagatcaaatggaaggccaagtcatgagg
atgggaggattagtaaatctcattggtggtacaaaaggagcagagttatcatgttttacc
ttttctcatattttggcggcgacagacaacttttcagagaaaaatttggttggtaagggt
ggatttggttatgtctacaagggcaatcttattaatggtcttaacgttgccattaaaaga
tttgatgcatgttcatcatatcaaggtccacatgagttcagaactgagattgatgccatt
ccaaatcttcgacacaagaacataattggtctacttgggtactgtgttcaaggagaagaa
agcatacttgtctatgaatatatgtcaaataaatgcttggcatctgtcattgctgatgaa
acaaaaagggggttgctaaattggtccaagcgtcttcaaataatcaaaggcatagcagat
ggtcttgcttttctgcatgggcattctcagatgtgcattgtccacagggacataaaacca
agcaacatcctgctggaccatgaaatgaatgccaagattactgattttggtctggcatta
atgttggctccaaaatcgactgcagaggttcctgttttgggcacatatggctatgcagat
cctgaatatattgttactggaaaaatctcggagaaggcagacatatatggatttggcata
gtactttttgagataataagtggaaggtcgatccattcttatatgaaggcagagggcact
cgagagctaccataccctgcttatgcacacaaatacaacccaaagacgctgcacaagctt
gttgatccattgttgcgcgtggacgagcatgaacgggctcagattatggaatgcgtgagg
gtggcgcagttatgcgttgaccatcgtgccaagcatcggcctgtgatgtcagaagttgtc
accatgcttggcatggcagcatcaaagggatag

DBGET integrated database retrieval system