KEGG   Zea mays (maize): 100272983Help
Entry
100272983         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100272983
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zma  Zea mays (maize)
Pathway
zma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01230  Biosynthesis of amino acids
Module
zma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100272983
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100272983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 100272983
NCBI-ProteinID: NP_001140906
UniProt: B4FS35
Position
10
AA seq 383 aa AA seqDB search
MESLLASRSIRSSFSAVASTRGAASPRPSRVATLASAGAGARSRALRAGHTDSILEVLAQ
DDMLNAKELVQWENGLSFNDIAARQGIRIRRHCRPTASLKEIEEELGAPLNILEKIIWDK
EIEVAEGHAKKPLEEVIQAATKAPPSRDFYGALEAAYKRNGVPALIAEVKKASPSRGVLR
ENFNPVEIAQAYEKNGAACLSILTDEKYFQGSFDNLEKVRSSGVKCPLLCKEFVIDKWQI
YNARSKGADAILLIAAVLPDLDIRKFLQICEELGMTALIEVHDEREMERVLKINGVKLIG
INNRSLETFVVDTSNTKMLLEKHGDIIREKGILVVGESGLFTPDDVAYVQNAGVSAVLVG
ESLVKQECPGRAIVGLFGKELLH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctcctcgcctcgcgatccattaggtcttccttctccgccgtcgccagcacc
aggggcgccgcttcccccaggccctcgcgcgtcgccaccctcgccagcgccggcgccggc
gcccgctcccgcgcgctccgtgctggccacacggactcaatccttgaggtgctggcacag
gacgatatgctgaacgcaaaggagctggtccaatgggagaatggcttgtcattcaatgac
atagcggctaggcaggggattcgcatccgcagacactgccgccccactgcctccttgaag
gagatagaggaggagctgggagccccccttaacatcctagagaagatcatttgggacaag
gagattgaagtagctgaggggcatgctaagaagcctcttgaggaggtgattcaggctgca
acgaaagcccctccttcaagagacttctatggcgctttagaagctgcctacaagcgtaat
ggggtgcctgcattgattgctgaggtcaagaaagcatccccgagtaggggtgtgctcagg
gagaactttaatcctgttgaaattgctcaagcttatgaaaagaatggagctgcatgtttg
agcattttgacagatgagaagtactttcagggaagctttgataatcttgaaaaggtgcgc
agctcaggagtgaagtgccctcttctctgcaaggagtttgtcattgacaagtggcaaatc
tataatgctcgctctaagggtgctgatgcaattctactaattgctgctgtgctaccagat
cttgacataaggaaatttcttcagatttgcgaagagttgggaatgacagctcttattgag
gttcatgatgaaagagagatggaacgtgtgctgaagataaatggagttaagcttattggt
atcaataaccgaagccttgagacatttgttgttgatacttcgaacaccaagatgttgctc
gagaaacatggggatatcatcagggagaagggaattttggttgttggtgaatcaggtctg
tttactccggatgatgttgcttatgttcagaatgctggcgtttctgctgttttggttggg
gaatccctggtgaagcaagagtgccctggacgagccattgttgggttatttggcaaagaa
ctgctgcactga

DBGET integrated database retrieval system