KEGG   Zea mays (maize): 100273338Help
Entry
100273338         CDS       T01088                                 

Gene name
pco062997c
Definition
(RefSeq) uncharacterized protein LOC100273338
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zma01001]
    100273338 (pco062997c)
   01009 Protein phosphatases and associated proteins [BR:zma01009]
    100273338 (pco062997c)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100273338 (pco062997c)
Protein kinases [BR:zma01001]
 Serine/threonine kinases: Other
  Wnk family
   100273338 (pco062997c)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100273338 (pco062997c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100273338
NCBI-ProteinID: NP_001141251
UniProt: B4FUQ8
Position
7
AA seq 324 aa AA seqDB search
MAVDRVDGEEAFEEVDPTGRFGRYADVLGLGSVKKVYRGFDQEEGIEVAWNRVRLRSLAD
RDPGMVERLHAEVRLLRSLSHDHIIGFHKVWLDRDAGVLNFITEVCTSGSLREYRHRHRH
VSVKALKKWARQILEGLNHLHTHDPCIIHRDLNCSNVFINGNNGQVKIGDLGLAAIVDKT
HVAHTILGTPEFMAPELYTETYTESVDIYSYGMCVLEMVTREVPYAECGSVVQIFHNVTR
GVPPAALKRLKDAELRGFIERCIGQPRNRPSAADLLQDPFFNGVRGGDDDDDAAALADAS
SVVAAAPVPRPRSYVDDLAGLRLD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaccgcgtggacggcgaggaggcgttcgaggaggtggacccgacggggcgg
ttcgggcggtacgcggacgtgctggggctcgggtccgtcaagaaggtgtaccgcgggttc
gaccaggaggaggggatcgaggtggcgtggaaccgcgtccggctgcggtcgctggccgac
cgcgaccccggcatggtggagcgcctccacgccgaggtgcgcctcctccgctcgctcagc
cacgaccacatcatcggcttccacaaggtgtggctggaccgcgacgccggcgtcctcaac
ttcatcaccgaggtctgcacctccgggagcctccgcgagtaccgccaccgacaccgccac
gtctccgtcaaggcgctcaagaagtgggcgcgccagatcctcgaggggctcaaccacctc
cacacccacgacccctgcatcatccaccgcgacctcaactgcagcaacgtcttcatcaat
ggcaacaacggccaggtcaagatcggcgacctcgggctggcggcgatcgtggacaagacg
cacgtggcgcacaccatcctgggcacgccggagttcatggcgccggagctgtacacggag
acgtacacggagtcggtggacatctactcgtacggcatgtgcgtgctggagatggtcacg
cgggaggtgccctacgccgagtgcggcagcgtcgtgcagatcttccacaacgtcacccgg
ggcgtcccgcccgcggcgctcaagcggctcaaggacgccgagctgcggggcttcatcgag
cgctgcatcggccagccccggaaccggccctcggccgctgacctcctgcaggaccccttc
ttcaacggcgtccgtggcggggacgacgacgacgacgccgcggcgctcgccgacgcctcc
agcgtcgtcgccgccgcgcccgtgccgcgccccaggagctacgtcgacgacctcgccggg
ctccggctggactga

DBGET integrated database retrieval system