KEGG   Zea mays (maize): 100273491Help
Entry
100273491         CDS       T01088                                 

Definition
(RefSeq) histone H2B.4
  KO
K11252  histone H2B
Organism
zma  Zea mays (maize)
Brite
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100273491
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100273491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like RP-C TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 100273491
NCBI-ProteinID: NP_001141398
UniProt: P49120 B4FVW9
Position
3
AA seq 137 aa AA seqDB search
MAPKAEKKPAEKKPTEEKAEKKPRAEKRVPGKEGGEKKGKKKAKKSVETYKIYIFKVLKQ
VHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSREIQTSVRLVLPGELA
KHAVSEGTKAVTKFTSS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagcccgcggagaagaagccgacggaggagaaggccgag
aagaagcccagggcggagaagcgcgtgccgggcaaggagggcggcgagaagaaggggaag
aagaaggccaagaagagcgtcgagacgtacaagatctacatcttcaaggtgctcaagcag
gtgcacccggacattggtatctcgtccaaggccatgtccatcatgaactccttcatcaac
gacatcttcgagaagctggctgccgaggccgccaagctcgcccgctacaacaagaagccc
accataacctcccgggagatccagacttcggtgcgcctcgtccttcctggcgagctcgcc
aagcacgccgtctccgagggcaccaaggccgttaccaagtttacttcctcttag

DBGET integrated database retrieval system