KEGG   Zea mays (maize): 100273552Help
Entry
100273552         CDS       T01088                                 

Gene name
pco137357
Definition
(RefSeq) uncharacterized protein LOC100273552
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zma01001]
    100273552 (pco137357)
   01009 Protein phosphatases and associated proteins [BR:zma01009]
    100273552 (pco137357)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100273552 (pco137357)
Protein kinases [BR:zma01001]
 Serine/threonine kinases: Other
  Wnk family
   100273552 (pco137357)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100273552 (pco137357)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 100273552
NCBI-ProteinID: NP_001141442
UniProt: B4FW86
Position
2
AA seq 510 aa AA seqDB search
MAPEVYEEEYNELVDIYSFGMCVLEMVTFEYPYSECTHPVQIYKKVISGTKPESLYKVKD
PMVRHFVEKCLATASQRLSARELLEDPFLQSDDVVASLDGGNYHVPANYIPQPSYLGHTY
SNGSMMSNGFSESIDEDALSEDCEDDDMKGQDGIDLFNENEGELLGNVDITIKGRKSEDG
GIFLRLRISDDDGRVRNIYFPFDVEADTALSVATEMVAELDITDHEVTRIADMIDGEVSA
LVPDWRPGPGIEEAPDTSYCHDCGSIVSSCGSLYAYMSSGRRGCQCAEVHGRFEEITFEA
DGEQCDLQESAGSSDDGGGPTEHYVKGKESTHVNGLLQMGRRDLSNQLCFSSFQEQSCSS
NHYENETNHHTNGFDMKHEVKIAKYKARKMAQLKRAIHPSLDFDNANGVNRMKPSLNKLQ
SFHIGKNHSFRVPTGDRSPGKVSTDYHSNLNSQLSHSRHPDPGAQRAWHCEVNAAGSSDC
MFTARRYYAGAQLPPNLPRTKSVPLHAVDV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggaggtgtacgaggaggagtacaacgagctggtggacatctactcgtttgga
atgtgcgtgctcgagatggtaacgtttgagtacccgtacagcgagtgtacacaccctgtg
cagatctacaagaaagtgatctctggtactaagccagaatctctgtacaaggtgaaagat
ccaatggtgaggcacttcgtcgagaagtgcctagcaacggcatctcaaagactgtcagca
agagaactgcttgaggatcccttcctacaaagtgatgacgtggttgcttctttggatggt
ggaaattaccatgtgccggccaattatatacctcagccttcatatttagggcatacctac
agcaatggctccatgatgagtaatggattctcagaaagcattgatgaagatgctctcagt
gaagactgcgaggatgatgacatgaaaggccaagatggcattgacctgttcaacgagaat
gaaggtgagcttcttggcaatgtggatataacaatcaaagggagaaagagtgaggatgga
ggcatattccttagattgcggatttctgatgatgatggacgggtacgcaacatctatttt
ccttttgacgttgaggctgataccgcactaagtgttgctactgaaatggtagccgaactc
gatataactgaccatgaagttactcggattgctgacatgattgatggtgaggtcagtgca
ctggtaccagattggaggcctggtccgggcatagaggaggctcctgacacttcatactgc
cacgattgtggatccatcgtgtcatcgtgtggttcactttacgcctacatgtcatcaggc
cgtcgaggttgccaatgtgcagaggtacatgggcggtttgaggagatcacgttcgaagct
gatggagagcagtgtgatttgcaggaatctgcaggcagctctgatgatggaggtggccca
acagagcactatgtcaaaggcaaggagtccactcatgtgaatggccttctacagatgggt
agaagagatctttctaatcagctttgcttcagttcattccaagagcaatcatgttcatct
aaccattatgagaacgaaactaaccatcacacaaatgggttcgacatgaagcatgaggta
aagattgccaagtacaaagcacggaaaatggcacagttaaagagggctatccatccatct
cttgacttcgacaatgcaaatggagtaaataggatgaagccttcactgaacaagctgcaa
tctttccatattggaaagaaccacagtttccgggtaccgaccggtgaccgaagcccgggt
aaagtaagtacggattaccattctaatttgaacagccaattatcgcatagcaggcacccc
gatccaggagcccaaagggcctggcattgtgaggtcaatgcagctgggagctctgattgt
atgtttacagcaaggcgctactatgccggagctcagttgccaccaaatctcccgcgaaca
aaatctgtacccctacatgctgtcgacgtctga

DBGET integrated database retrieval system