KEGG   Zea mays (maize): 100279581Help
Entry
100279581         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100279581
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
zma  Zea mays (maize)
Pathway
zma03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100279581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zma01009]
    100279581
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zma03036]
    100279581
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100279581
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100279581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 MOR2-PAG1_N
Motif
Other DBs
NCBI-GeneID: 100279581
NCBI-ProteinID: NP_001146050
UniProt: B7ZYW1
Position
8
AA seq 455 aa AA seqDB search
MSSAVFPSSVVAGIEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSDPDRSSVEKDIKRQ
ALLDLIEFVESTNARFSEAAVVACSRMCAVNLFRAFPASCRSGGSSGVGECDEDEPMFDT
GWCHLHLVYELLLKFIGSSSLDAKIGKKHFDHSFIVKLLDLLHSEDPRERDCVKNILHRV
YGKFMVHRPFIRRAASNVFYQFVFETDRHNGIAELLEVFGSVISGFALPLKEEHKTFLWR
VLVPLHKPKSLGAYLQQLTYCVTQFIEKDPELASPVIIGLLRYWPITNCQKEVMFLSEIE
EILEATSQAEFQKCMAPLFRRIAHCITSAHFQVAERALFMWNNDHIVSLIAQNRQVIMSL
VVPALEQNIQNHWNQAVLNLAVNVKKMFSEMDGDHFSSCLARYKEEEERLVSLEAKRKLT
WEKLESAAAFQPVTGQTAVLVGHQPSANMIANLIF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgccgtcttcccctcgagcgtcgtggctggcatcgagccgctggtctcgttc
aaggacgtgcccagctcggagaagcagagcctgttcgtgagcaagctgagcctgtgctgc
gtcgtgttcgatttctcggacccggacaggagttcggtggagaaggatatcaagcggcag
gcactgctggatcttatagagttcgtcgagtcgaccaacgctcgcttctcggaggcggcg
gtcgtggcctgctctaggatgtgcgccgtcaacctgttccgggcgttccctgcaagttgc
aggtctggcggctcatcaggcgtcggtgagtgcgacgaggacgagccaatgttcgatact
gggtggtgccatctgcaccttgtttatgagctgctactgaagtttatcggatcctcgtcc
ttggatgcaaagatagggaagaagcactttgatcactcgttcattgtgaagctccttgat
cttcttcactccgaggatccaagggaaagggattgcgtgaaaaacattctgcacagggtg
tatgggaagttcatggtgcaccgtcctttcattcgcagagcggcgagcaacgtattctac
cagttcgtcttcgagactgatcgacataatgggatcgcagagctgctggaggtctttggc
agtgtcattagtgggtttgcactgcctctgaaagaagagcacaagacctttctttggaga
gttttggttcctttgcacaaaccaaaatctcttggtgcgtaccttcagcagttgacctac
tgtgtgacacagtttatagaaaaggatccagagctcgcaagcccagtgataattggtttg
ttaaggtactggccaataacaaattgtcagaaggaagtgatgtttctcagcgagatcgaa
gagatcttggaggctaccagccaggcagaattccagaaatgtatggcaccattgtttcgg
cgaattgctcattgtatcaccagtgctcacttccaggttgctgaaagagcgcttttcatg
tggaacaatgatcacattgtcagcttgatagcacaaaaccgccaagtgatcatgtctctt
gttgttccagcgctagagcagaacattcagaatcactggaaccaagcggtcctgaatctg
gctgtgaatgtcaagaaaatgttttctgagatggatggtgaccatttctcgtcgtgcctg
gccaggtacaaggaggaagaagaaagacttgtgtcgctagaagcgaagcgtaaacttacc
tgggagaagcttgagtcagctgcagccttccagccagtgactggccaaacagccgtccta
gtaggccaccagccgtcagcaaatatgatcgccaacctgatcttctag

DBGET integrated database retrieval system