KEGG   Zea mays (maize): 100279865Help
Entry
100279865         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100279865 isoform X1
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100279865
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     100279865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 100279865
NCBI-ProteinID: XP_008651347
UniProt: B8A0D6
Position
7
AA seq 557 aa AA seqDB search
MAAVWSRIGRGAQLSLSLSLSRTFYDGASAASTLRSAAALSRARGQHASSLHSLAGRSAG
HLLQPPSRGIVTTPARLHPASSAAVVAELSDAEARESEAVAAPPRQMPSLGPTRPGEKPR
VVVLGTGWAACRLLKDVDTRAYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVVEPVSRIQ
SALATRPGSYFFLASCTGVDTKAHEVYCEAASSDGQLPCHPYRFKVAYDKLVIASGAEPL
TFNIKGVQEHAIFLREVSHAQEIRRKLLANLMLAENPGLSAEEKERLLHCVVVGGGPTGV
EFSGELSDFITRDVRQRYAHVKDYVKITLIEANEILSSFDIGLRQYATNHLSKYGVNLVR
GIVKEVKATEITLSDGTRVPYGLLVWSTGVGPSEFVRSLHLPKSPGGRVGVDEWLRVPTA
PDVFALGDCAGFLEGTGKPVLPALAQVAEREGRYLARLLGRIAAQNGGKAHCAGKADLGE
PFVYKHIGSMASVGRYKALVDLRENKDAKGVSMAGFLSWLMWRSAYLTRVVSWRNRFYVA
VNWGTTLVFGRDNTRIG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgtggtctaggatcgggaggggagcgcagctgtcgctgtcgctgtccctg
tcgaggaccttctacgacggcgcgtcggcggcttccacgctgcgcagtgctgccgcgctg
tcccgcgcccggggccagcacgcgtcgtcgctccacagcctcgcgggaaggtccgccggc
cacctcctccagccgccgagcaggggcatcgtgaccacgcccgcgaggcttcacccggcg
tcgtccgcggcagtggtggcagagctctcggacgcggaggcgagggagtccgaggccgtg
gcggcgccgcctcgccagatgccgagcctcggcccgacgcggcccggggagaagccccgc
gtcgtggtgctgggcaccgggtgggcggcgtgccggctgctcaaggacgtggacacgcgc
gcctacgacgtcgtgtgcgtgtccccccggaaccacatggtgttcacgccgctgctggcg
tccacgtgcgtcggcacgctcgagttccgctccgtcgtcgagcccgtcagccgcatccag
tcggcgctcgccacccgccccggctcctacttcttcctcgcctcctgcaccggcgtcgac
accaaggcgcacgaggtgtactgcgaggccgcgtccagcgacggacagctgccctgccac
ccgtaccggttcaaggtcgcctacgacaagctggtgatcgcgagcggcgccgagccgctc
accttcaacatcaagggtgtccaggagcatgccatcttcctccgcgaggtgagccacgcg
caggagatccgcaggaagctgctcgctaatctcatgctggccgagaatccaggcttgtct
gcggaagagaaggagcggctcctgcactgcgtggtggtcggcggaggacccaccggcgtc
gagttcagcggcgagctcagcgacttcatcacacgcgacgtgcgccagaggtacgcgcac
gtcaaggactacgtcaagatcaccctcatcgaggcaaacgaaatcttgtcatcgttcgat
atcggactgcggcagtacgcgacgaatcacctgtcaaagtatggagttaatctggtgcga
ggcattgtgaaggaggtgaaggccacggagatcaccctgagcgatggcacccgcgtgccc
tacggcctgctggtctggtccacgggcgtcggcccgtcggagttcgtcaggtccctgcac
cttcccaagtccccaggcgggagggtcggcgtggacgagtggctccgcgtgcccacggcg
ccggacgtgttcgcgctgggcgactgcgcgggtttcctggaggggaccggcaagccggtg
ctcccggcgttggcccaggtcgcggagcgggagggccggtacctggcgcggctgctcggg
aggatcgcggcgcagaacggcggcaaggcgcactgcgccggcaaggccgacctcggggag
ccgttcgtgtacaagcacatcggcagcatggcgtccgtcggccggtacaaggcgctcgtc
gacctcagggagaacaaggatgccaagggggtgtcgatggctggcttcctcagctggctg
atgtggcggtcagcgtacctgacgcgggtggtgagctggaggaacaggttctacgtggcg
gtgaactggggaacgacgcttgtgtttggcagggacaacaccaggattggctga

DBGET integrated database retrieval system