KEGG   Zea mays (maize): 100279895Help
Entry
100279895         CDS       T01088                                 

Gene name
si660041a03
Definition
(RefSeq) beta-glucosidase GBA2 type family protein isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
zma  Zea mays (maize)
Pathway
zma00511  Other glycan degradation
zma00600  Sphingolipid metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100279895 (si660041a03)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100279895 (si660041a03)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100279895 (si660041a03)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 100279895
NCBI-ProteinID: XP_008672952
UniProt: A0A1D6KTL3
Position
1
AA seq 974 aa AA seqDB search
MVSGHIFHCRKNSWPAEEYVGRTALQLLDFDGGAPPEQAWRRRLNSHANILKEFSVTFME
AMRMMSLGLRLWSYVREEASHGRKAPIDPFTKERCKPSASQGVPLGGMGSGSISRGFRGE
FKNWHIIPGLCESSPVMENQFSIFVSRDGGNKKYSSVLAPGHHEGLKKNSDSGISSWDWN
LSGQHSTYHALFPRAWTVYDGEPDPDLKISCRQISPFIPHDYKDSSLPTSVFVYTLVNTG
RDRAKVSLLMTWANSIGGFSHNSGGHYNEPFIAEDGVSGVLLHHKTAKDNPPVTFAVAAC
ETQNVNVTVLPVFGLSGENHVSAKEMWNTMLQNGHFDRENFSAGPSMPSSPGQKLCAAVS
ASTWVEPHGRCTVVFALAWSSPKVKFQKGCTYNRRYTQFYGTSEKSAVNLVHDALTKYKL
WEEEIEKWQNPILKDERLPEWYKFTLFNELYFLVAGGTVWTDGQPPAIDEKKSPGFNHQK
SSKRGTKDTNQGSVKDRHVNLAVEQVPHGGYMANGDDHSVSKFAAVHGSEMQEQINGLKS
EEPIPYLISKDGPEHVGKFLYLEGVEYIMWNTYDVHFYASFALLDLFPKIELSIQRDFAN
AVLYEDRRKVKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVL
QIYRDFAATGDMQFGRDVWPAVCAAMDYMDQFDRDGDGLIENDGFPDQTYDAWTVHGISA
YCGCLWLAALQAAATMAHRLGDRHFAEKYKLKFIKAKAVYEAKLWNGSYFNYDSGTSSNS
RSIQADQLAGQWYAASSGLPPLFDEHKIRTALQKIFEFNVMKVKGGRMGAVNGMTPKGKV
DETCMQSREIWTGVTYAVAANMLLHGMEHQGFTTAEGIFTAGWSEEGYGYWFQTPEGWTT
DGHYRSLVYMRPLAIWAIQYAVSPPKAILEAPKVNLMDRIHISPHMVRAISEISIRKVAP
DNRCFPSSAFHCEC
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcggccacatcttccactgccggaagaactcgtggccggcggaggagtacgtc
ggccggaccgcgctgcagctgttggatttcgatggcggggcgccgccggagcaggcgtgg
cggaggcggctcaacagccacgcgaacatcctcaaggagttcagtgtcactttcatggag
gcaatgaggatgatgagccttggcctgagactatggtcgtatgttcgggaggaggcgtca
catggacggaaagcaccgatcgatccgttcacaaaagagcgctgtaaaccgtcagcttcc
cagggtgtgccacttggtgggatggggagcggaagcatttcgagaggtttcaggggagag
ttcaagaattggcacatcatacctggtctttgtgaaagttcgccggtcatggagaaccag
ttctctatatttgtatctcgagacgggggtaataagaaatactcatcagttttggctcct
ggacatcatgaaggtctgaagaaaaatagtgactctggaatttcttcatgggactggaat
ttaagtggtcaacactcgacctatcatgcattgttccctcgggcatggactgtttatgat
ggtgaacctgatccagaccttaaaatctcatgtcgtcaaatatcacctttcattcctcat
gattacaaggatagcagtcttccaacatctgtatttgtgtatactctagtaaacactggg
agagatcgtgcaaaagtaagcctgttaatgacatgggcgaattctattggaggtttttcg
cataattcaggaggccactacaatgagcccttcattgcggaagatggagtatcaggagtg
cttctgcatcacaaaacagccaaggataatccacctgtcacttttgctgttgctgcctgc
gaaactcagaatgtgaatgtgacagtcttgccagtgtttggtctttctggagaaaaccat
gtttccgcaaaggaaatgtggaacaccatgctacagaatggtcactttgatcgggaaaat
ttcagtgctggtcccagtatgccttcttctccaggacagaaactctgtgcagctgtctca
gcctcaacttgggttgagccacatggtagatgtactgttgtgtttgctctggcttggtcc
tcacctaaagtaaagtttcaaaaaggatgcacatataacaggaggtacacccaattctac
ggaacttctgagaaatcggctgttaatttggtacatgatgccttaacaaaatataaactt
tgggaagaagaaattgagaagtggcaaaaccccatactgaaggatgaaaggcttccagaa
tggtataagttcactctttttaatgagctttactttctggtagctggggggactgtttgg
acagatggtcaacccccagcaatcgatgagaaaaagagtcctggttttaatcaccagaag
tcctcaaagaggggtactaaagacaccaatcagggatctgttaaagatagacatgtcaac
ctggcagtggagcaagtacctcatggtggttacatggctaatggtgatgatcacagtgta
tccaagttcgcagcagttcatggatcagaaatgcaagaacaaatcaatggactcaagtca
gaagagccaattccttacttgatttcaaaggatggccctgaacacgttggcaagtttttg
tatctagaaggagtggaatacatcatgtggaacacatatgatgtgcatttctatgcatct
tttgctctccttgatttgttcccaaaaatagagttgagtatccaacgtgattttgccaat
gctgtgctgtatgaagatcggcgcaaagtaaaatttttggctgatggtacatccggaatc
cgcaaggttaaaggtgcagtgcctcatgacctcggaacgcatgatccgtggcatgaaatg
aatgcatataacatacacgatacaagcaaatggaaagatttgaaccccaaatttgtgctc
cagatatacagagactttgctgctacaggtgatatgcaattcggtcgagatgtttggcct
gcagtctgtgctgctatggactatatggatcagtttgaccgtgatggtgatggtctcatt
gagaatgatggatttcctgatcaaacctatgatgcttggactgttcatggaatcagtgct
tactgtggttgtctttggcttgctgcacttcaagctgcagctacaatggctcatcgcctt
ggggatcggcactttgctgagaagtacaagctcaagtttataaaagccaaagcagtatat
gaggcgaagttatggaatgggtcatatttcaattacgacagcggcacaagtagcaacagt
agatccattcaggctgatcagctggcaggacagtggtatgctgcctcgtcgggcttgccc
ccgcttttcgatgagcacaagataagaactgctctgcaaaaaatatttgaattcaacgtg
atgaaggttaaaggaggacggatgggagctgtaaatggtatgactccaaagggaaaggtg
gacgagacatgcatgcaatcacgtgaaatctggactggtgttacatacgctgttgctgca
aatatgctgctccatggaatggagcatcaaggctttacgaccgcagaaggaatttttact
gcgggatggtcagaagaaggatatgggtattggttccaaacaccagaaggatggaccaca
gatgggcattatagatccctcgtatacatgcggcctcttgccatttgggcgatccagtat
gcagtttctcctcccaaggctattcttgaggcccccaaagttaacctaatggaccgaata
catatctcccctcacatggtccgagcaattagcgagataagcattagaaaggtagcaccc
gacaatagatgtttccctagctctgccttccactgtgaatgctga

DBGET integrated database retrieval system