KEGG   Zea mays (maize): 100280534Help
Entry
100280534         CDS       T01088                                 

Definition
(RefSeq) delta DNA polymerase
  KO
K03505  DNA polymerase delta subunit 4
Organism
zma  Zea mays (maize)
Pathway
zma00230  Purine metabolism
zma00240  Pyrimidine metabolism
zma01100  Metabolic pathways
zma03030  DNA replication
zma03410  Base excision repair
zma03420  Nucleotide excision repair
zma03430  Mismatch repair
zma03440  Homologous recombination
Module
zma_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100280534
   00240 Pyrimidine metabolism
    100280534
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100280534
   03410 Base excision repair
    100280534
   03420 Nucleotide excision repair
    100280534
   03430 Mismatch repair
    100280534
   03440 Homologous recombination
    100280534
DNA replication proteins [BR:zma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100280534
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100280534
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100280534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100280534
NCBI-ProteinID: NP_001146925
UniProt: B6SHY6
Position
10
AA seq 129 aa AA seqDB search
MTRGGGGDMKSFFRQQKTHAAAATTKPTGGVSKKAAAHHHKKAALATNVHPAPCTDPDHG
AGSRQQEEAEAEQRERAGREFDMDTRYGPCLGVTRAQRWRRAAALGLAPPPALLALCADE
QPCLWEGRV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggggcggcggaggcgacatgaagtccttcttccgtcagcagaagacgcacgcc
gccgccgccactaccaagcccactggcggcgtctccaagaaggcggcggcgcatcaccac
aagaaggccgcactcgccaccaacgtccacccggccccatgtaccgatcccgatcacggc
gccggcagccgccagcaggaggaggcggaggcggagcagcgggagagggcgggccgcgag
ttcgacatggacacgcgctacgggccatgcctcggcgtcacccgcgcccagcggtggcgc
cgcgccgccgcgctcggcctcgcaccgccgccggcgctcctcgccctctgcgccgacgaa
cagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system