KEGG   Zea mays (maize): 100281136Help
Entry
100281136         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100281136
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
zma  Zea mays (maize)
Pathway
zma00906  Carotenoid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Module
zma_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    100281136
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     100281136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 100281136
NCBI-ProteinID: NP_001147527
UniProt: B6SSJ7
Position
3
AA seq 631 aa AA seqDB search
MIHPPLPPHPHSAVSGSLNSHNTLQPAMQALTARSPASSSCPSSSTVHRRGGTRTRSTAR
FAPPRAAAAAANSVFSAPPAAVRYAAPPKPAAPIAPVPAPAPAAGGEKGLSFLQRAASAA
LDAFESGVIAGLLERPRALPRSADPAVQIAGNFAPVGEQPPVRSLPVSGRIPPFISGVYA
RNGANPCFDPAAGHHLFDGDGMVHAVRIRNGAAESYACRFTETARLRQERALGRAVFPKA
IGELHGHSGIARLALFYARGLCGLVDASRGTGVANAGLVYFNGRLLAMSEDDLPYQVRVT
ADGDLRTVGRYDFEGQLGCASMIAHPKLDPASGDLFALSYDVIRRPYLRYFYFRPDGTKS
DDVEIPLEQPTMIHDFAITERFVVVPDHQVVFKLGEMLRGGSPVVLDQGKTSRFGVLPKY
ARDASEMVWVDVPDCFCFHLWNAWEEPGTGEVVVVGSCMTPADSIFNDDGGEDGRLQSVL
TEIRLDTRTGASTRRAVLPPSAQVNLEVGMVNRNMVGRRTRYAYLAVAEPWPKVSGFAKV
DLDTGDLVRFDYGDGRFGGEPCFVPTEGAPARGEDDGYILSLVRDERAGTSELLVVNAAD
MRLEATVQLPSRVPYGFHGTFIGERELEAQA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatccatcccccgcttcctcctcatccacactccgcagtgtcggggtcgctcaactcc
cacaacactctgcagccagcgatgcaggccctcacagcgaggtcccctgcttcttcgtcc
tgcccttcctcctccaccgtacaccgccgcggcggcacgcgcacgcgcagcaccgcccgc
ttcgccccgccccgcgccgcagcggcagcggccaactcggtcttcagcgcgccgcccgca
gccgtgcgctacgccgcgccgcccaagccggcggcgcccattgcgccagtgcccgctccg
gcgccggcggcgggcggcgagaaaggcctgagcttcctgcagcgcgcggcgtcggcggcg
ctggacgcgttcgaatccggcgtgatcgcgggcctcctggagcgtccccgcgcgctgccc
cggtcggcggacccggccgtgcagatcgccggcaacttcgcccccgtcggcgagcagccg
cccgtgcggtcgctgcccgtgtcgggccgcatcccgcccttcatctccggcgtgtacgcg
cgcaacggcgccaacccctgcttcgaccccgccgcggggcaccacctgttcgacggcgac
ggcatggtgcacgcggtccgcatccgcaacggcgccgcggagtcgtacgcgtgccgcttc
accgagacggcgcggctccggcaggagcgcgccctggggcgggccgtgttccccaaggcc
atcggcgagctgcacggccactccgggatcgcgcgcctggcgctcttctacgcgcgcggc
ctctgcggcctcgtcgacgcgtcccgcggcacgggcgtcgccaacgccggcctcgtctac
ttcaacggccgcctgctggccatgtccgaggacgacctaccgtaccaggtgcgcgtgacc
gccgacggggacctccgcaccgtcgggcgctacgacttcgaagggcagctcgggtgcgcc
agcatgatcgcgcaccccaagctggacccggcctccggcgacctcttcgcgctcagctac
gacgtcatccggcggccctacctgaggtacttctacttccggcccgacggcaccaagtcc
gacgacgtggagatcccgctggagcagccgaccatgatccacgacttcgccatcacggag
cggttcgtggtggtgcccgaccaccaggtggtgttcaagctcggcgagatgctccgcggc
gggtcccccgtggtgctggaccagggcaagacgtcccgcttcggcgtgctgcccaagtac
gcgcgcgacgcgtcggagatggtgtgggtggacgtgccggactgcttctgcttccacctg
tggaacgcgtgggaggagcccggcacgggggaggtggtggtggtcgggtcctgcatgacc
cccgccgactccatcttcaacgacgacggcggcgaggacgggcggctccagagcgtgctg
accgagatccggctggacacgcgcacgggcgcgtccacgcgccgcgccgtgctgcctccg
tcggcgcaggtgaacctggaggtcgggatggtgaaccgcaacatggtggggcggaggacg
cggtacgcgtacctggccgtggcggagccgtggcccaaggtgtccgggttcgccaaggtg
gacctggacacgggcgacctcgtccggttcgactacggcgacggccgcttcggcggggag
ccctgcttcgtgcccaccgagggcgcgccggcgcgcggcgaggacgacggctacatcctg
tccctcgtccgcgacgagcgggcgggcacgtcggagctcctggtagtgaacgccgccgac
atgcggctggaggccacggtccagctaccctcccgcgtgccctatggcttccacggcacc
ttcatcggcgaacgggagctagaggcccaggcctga

DBGET integrated database retrieval system