KEGG   Zea mays (maize): 100281352
Entry
100281352         CDS       T01088                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
zma  Zea mays (maize)
Pathway
zma00100  Steroid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Module
zma_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100281352
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100281352
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 100281352
NCBI-ProteinID: NP_001147742
UniProt: B4FS76
Position
2
AA seq 370 aa
MEAAAAVLPTLVPSGSAVVVLLAYLGYLAAAGAILPGKLVDGALLPDSSRLHYRCNGLLS
LLLLLGLSAFGVYMGWMSPTVVADMGLELLSVTFIFSVIVSFALYIAGIKSGHKSSSLRP
HVSGSFMQDWWFGVQLNPHFMEVDLKFFFVRAGMMAWLFINLSLFAKSYFAGSANLSVIL
YQFFCAWYIIDYFVHEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLKNKVEL
SLLSGLANLCIFLIGYLVFRGANKQKHVFKKDPKAPIWGKPPKVVGGKLLASGYWGIARH
CNYLGDLLLALSFSLPCGVSSVVPYFYPTYLLILLVLRERRDEARCSQKYREIWAEYCKL
VPWRILPYVY
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggaggccgccgcggccgtcctccccacgctggtgccctccgggagcgcggtggtggtg
ctcctcgcctacctcgggtatctcgccgccgctggagccatcctcccagggaagctcgtc
gacggagccctactcccggactcctctcgcctccactatcgctgcaacggtttgctctcg
ctcctgctgctgctgggactctcggcgttcggtgtctacatggggtggatgtctcccacg
gttgtagctgacatgggactcgaacttctgtcggtgacctttatttttagtgtcattgtc
tcttttgcactctacattgccggcatcaagtccggccacaaaagttcttctttgagacca
catgttagtgggagcttcatgcaagattggtggtttggagtgcaacttaatcctcatttt
atggaagttgacctcaaattcttctttgtgagggcaggaatgatggcatggttatttatt
aacctctctttgtttgcaaagagctactttgctggttcagccaatctttcggtcattctc
taccaatttttttgtgcgtggtatatcattgattacttcgtccatgaagaattcatgacc
tcaacgtgggacattattgctgaaagactgggtttcatgctggtgtttggtgatctagtt
ttcatccctttcaccttcactattcaggggtggtggcttttgaagaacaaagtagagctg
tcccttttgtctggtctagctaacttatgcatctttcttattggctacctagtgttccga
ggagctaacaagcaaaaacatgtgttcaagaaggaccccaaagctcctatatggggaaaa
cctcccaaagttgtcgggggaaagctactagcatctggttactggggcatcgcaaggcac
tgcaattatctcggagacctgctgctagcactttcgttcagcttgccctgtggagtgagt
tccgtggtcccatacttctaccccacgtacctgctcattctactggtcttgagggaaagg
cgcgatgaggcgaggtgctcgcagaagtacagggagatctgggcagagtactgcaagctc
gtgccgtggaggatcctgccttatgtgtactga

DBGET integrated database retrieval system