KEGG   Zea mays (maize): 100282861Help
Entry
100282861         CDS       T01088                                 

Definition
(RefSeq) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
zma  Zea mays (maize)
Pathway
zma00260  Glycine, serine and threonine metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100282861
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     100282861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Rep_fac-A_C
Motif
Other DBs
NCBI-GeneID: 100282861
NCBI-ProteinID: NP_001149239
UniProt: B6TC55
Position
10
AA seq 375 aa AA seqDB search
MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV
PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID
SIVAAIRPPGGGLYYPTTRLICLENTHGNSGGKCLSAEYTEKVGEIAKSHGLKLHIDGAR
IFNASVALGVPVDRLVRAADSVSVCISKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMR
QVGVLCAAAHVAVRDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIVDSR
ISSNKLCQVLGTHNVLASPRSPKRLVLHYQISDDDVQYALTCFKKAAEQLLMGSTELEHL
AEQLLMGTTKNSYGQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaggtggtggtggacctgcggtccgacacggtcaccaagccttccgaggcc
atgcgcgcgtccatggccgcggccgacgtcgacgacgacgtccggggcgcggacccgacc
gcgcgccgcttccaggaggagatggcggcgctcatgggcaaggaggccgcgctcttcgtc
ccgtcggggaccatgggcaacctcgtgtccgtcctcgcgcactgcgacgtccgcggcagc
gaggtcatcctcggcgacgactcgcacatccacctctacgagaacggcggcatctccacc
ctcggcggcgtgcaccctaagaccgtcagaaacaactccgacggcaccatggacatcgac
agcatcgtcgctgcaatcaggcctcccggcggtggcctgtattacccgaccaccaggctc
atctgcttggagaacacacatgggaattccggagggaagtgtttatccgcagaatacact
gaaaaggttggcgaaattgccaagagtcatggcctgaagcttcatatcgatggagctcgc
attttcaacgcctctgtggcacttggagttcctgtggacagacttgtgagagctgcagat
tcagtttcggtatgcatttctaaaggtttaggcgcccccgttggatcagttattgttggc
tcgaaggccttcatcgacaaggccaaaattctccggaagaccctaggtggtggaatgagg
caggttggagttctctgtgctgctgctcatgttgccgttcgtgacaatgtgggaaagctt
gcagatgaccacagaaaggctaaagctttggcagacggactgaataaaatcgaacagttc
agagtggattcagcatcagtccagaccaatatggtattcttggacatcgtggattcacgc
atatcatctaacaagctgtgccaggttctgggaacgcacaatgtgctcgcaagtccaagg
agtccaaaaaggcttgtccttcattaccaaatttcagatgatgatgttcaatatgcactg
acgtgttttaagaaagctgctgaacagctactaatgggcagtactgaactcgagcatttg
gctgaacagctactgatgggcactaccaagaactcgtacgggcaatag

DBGET integrated database retrieval system