KEGG   Zea mays (maize): 100282868Help
Entry
100282868         CDS       T01088                                 

Gene name
pco091084
Definition
(RefSeq) uncharacterized protein LOC100282868 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00562  Inositol phosphate metabolism
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100282868 (pco091084)
   00562 Inositol phosphate metabolism
    100282868 (pco091084)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100282868 (pco091084)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100282868 (pco091084)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 UspA1_rep
Motif
Other DBs
NCBI-GeneID: 100282868
NCBI-ProteinID: NP_001149246
UniProt: B6TC70
Position
1
AA seq 524 aa AA seqDB search
MGMAAPRAPLPLPQLLLLLVAALLAAAPLPRAARADEFDVRRHLSTVTRYDVARESSSVI
SMPSIPDGCRVIHLNLVARHGTRAPTKKRIKELDRLAVRLEALLKEANQVLDSDSLKKIP
SWIKGWESRWKGRTKGGELISEGEEELYNLATRMRERFQDLFDDEYHPDVYSIRATQVPR
ASASAVAFGLGLLSGKGKLGQGKNRAFSVLSESRASDICLRFFDSCETYKAYRKRKEPDV
EKQKEPILEHVTAALVNRYHLKFTTRDVSSLWFLCKQEASLLNTTNQACGLFNEAEVRFL
EWTDDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIIAREENRADGTFEKARLRFAHA
ETVVPFSCLLGLFLEGPEIEKIQREEALDLPPLPPQGRNWKGSVVAPFAGNNMLVLYQCP
SKISDGSTISGGRNNSYLVQVLHNEVPVSMPGCGNKDFCPFEEFKEKIVKPHLKHDYNMI
CKVKSPAASEEPASFASRVSSFFLGLLSQKGYRGVGAEGVKTEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggctgctccgcgcgcgccgctgcctctcccccaactgctgctcctcctcgtt
gccgcgctcctcgccgccgctcccctccctagggcggccagggcggacgagttcgacgtc
cgccgccacctctccaccgtcaccaggtatgatgtggccagggagtccagtagtgtcatc
tccatgccgtcaatcccagacgggtgccgtgtcattcacctcaatttagtggcaagacat
gggactcgcgctcctaccaagaagcgcatcaaggagctggatagattggcagttcgactg
gaagcccttctgaaagaggcaaatcaggtccttgatagtgattctctgaagaaaattcca
tcctggattaaaggctgggaatcacgctggaagggtaggactaaaggtggtgagctgatt
agtgaaggggaagaggagctttacaatttagctaccagaatgagggagaggtttcaagat
ctatttgatgacgaatatcaccctgatgtatattcaataagagcaacccaggttcctcga
gcatcagctagtgcagtggcatttgggttgggactactttctgggaaaggaaagcttgga
caagggaagaaccgagccttttctgttctgagtgagagtcgtgcaagtgatatttgtctg
agattctttgacagctgtgagacatacaaggcatacaggaaaaggaaggagcctgatgta
gagaagcaaaaggaaccaattctagagcatgtcacagctgcacttgtcaatcgttatcac
ctaaaatttacaactcgcgatgtttcttccctctggtttctttgtaagcaggaagcatct
ttgttgaatacaacaaatcaagcttgtgggctttttaatgaagctgaggttcgttttctg
gagtggacagatgatttggagggttttgttctaaaaggctatggtgagtcaattaactac
aggatgggactgccattgctcaaggatgttgtccagtcaatggaagaagcaatcatagct
agagaagaaaaccgtgctgatggtacgtttgaaaaggcaaggctccgatttgcacatgca
gaaactgttgttccttttagctgccttcttggtctttttcttgaaggtccagaaattgag
aagatacagagagaggaagcattggacctaccccctttgccgccacagggaagaaactgg
aagggcagtgttgttgcgccttttgctggtaacaatatgctggttttatatcaatgtcca
agcaaaatttcggatggcagcacaatctctggaggccgaaacaactcttacttagttcaa
gttctacacaacgaagtcccagtttcaatgcctgggtgcggcaacaaagatttctgtccg
ttcgaggagttcaaggagaaaattgtgaaaccgcacctgaagcacgactacaacatgata
tgcaaggtcaaatccccagcggcaagcgaggagcctgcctcgttcgcctccagggtgtcc
agtttcttcctaggactcctctcgcagaaagggtaccgcggtgtgggcgccgagggcgtc
aagaccgagctgtag

DBGET integrated database retrieval system