KEGG   Zea mays (maize): 100282904Help
Entry
100282904         CDS       T01088                                 

Gene name
si486076e09b
Definition
(RefSeq) uncharacterized protein LOC100282904
  KO
K17890  autophagy-related protein 16-1
Organism
zma  Zea mays (maize)
Pathway
zma04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:zma00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    100282904 (si486076e09b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    100282904 (si486076e09b)
   03029 Mitochondrial biogenesis [BR:zma03029]
    100282904 (si486076e09b)
Membrane trafficking [BR:zma04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100282904 (si486076e09b)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100282904 (si486076e09b)
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100282904 (si486076e09b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 GlcNAc-1_reg Lebercilin DUF1664
Motif
Other DBs
NCBI-GeneID: 100282904
NCBI-ProteinID: NP_001149282
UniProt: B6TCK6
Position
1
AA seq 508 aa AA seqDB search
MTMAEAEAGRAAIRRALRSLKRRHLAEEGAHSPAIEALTRPFAAHALEWKEKAEKHELEL
QQCYKAQSRLSEQLVTEIEEGKVSKALLKEKEAMVTSLQAELEKTSEENVQLKQSLDEKI
KALDLLIQEHQTVKAELEQALTKLKAAEDENQNLVDRWMLEKMKDAERLNEANAMYEEMV
LKLKTAGVGGIQLNAQQETDGIIRRSEAGYIETPIPSTCTITIRAHDGGCGALMFEHNSD
KLISGGQDQAVKIWGASTGALTATLHGCLGSVNDLAVTNDNKFVIAACSSNKLFVWEVSG
GRPRHTLTGHTKNVSSVDASWVKSFVVASSSSDRTIKVWDLQTGFCKSTIMSASNPNSLA
FIDGDTICSGHRDGNLRLWDIRSGKCTTQIAAHLDVTSVCVSRSRNFVLTSGRDNVHNLF
DVRTLEICGTFRAMGNRVVSSWGKPSISPDENCIAAGSSDGSVYIWSRLKNGTPTILEGG
HSSPVLASAWCGLGALATSDRNHIYIWS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggccgaggccgaggctggtagggcggcgatccggcgcgccctgcggtcgctg
aaacggaggcatctcgccgaggaaggggcgcacagcccggccatcgaggcgctaacccgt
cccttcgccgcccacgctttggagtggaaggagaaggctgaaaagcatgagttagagctg
cagcaatgctacaaggcgcaatcccggctctctgagcagcttgtgactgagatagaagaa
ggtaaagtatcaaaagcactgctcaaagagaaggaagcgatggttacaagtttgcaggct
gaacttgagaagacaagcgaagagaatgtacaactaaagcagtcgcttgacgaaaaaata
aaagccttagatcttctcattcaagagcatcagacagtgaaagccgagcttgaacaagca
ttgacgaaactaaaagctgcagaggatgagaaccaaaatctggttgatcgatggatgcta
gagaagatgaaggatgccgagaggctcaatgaggccaatgcgatgtatgaggagatggtt
ctaaagctaaagacagctggagttggtggtatacaacttaatgcacagcaagaaactgat
ggcatcatacggcgttctgaagctggttacatagaaacgccaatcccatcaacatgcaca
ataactatccgtgctcatgatggtgggtgtggagctttgatgtttgagcataactcagac
aagctaattagtgggggtcaggatcaagctgttaagatatggggtgcatctaccggcgcc
ttgaccgccaccctgcatggttgcttggggtctgttaatgatcttgccgtgaccaacgat
aacaagtttgtgatcgctgcctgtagctccaacaagctgtttgtgtgggaagtcagtggg
ggacgtcctcgccacacgctgactggtcacacgaaaaatgtttcttctgttgatgcaagc
tgggtgaagagctttgttgttgctagttcatccagtgaccgtactatcaaggtttgggat
ctacagacaggtttctgcaagagcaccataatgtccgcgagcaaccccaactcgctagct
ttcatcgatggtgacaccatctgttcgggtcacagggatgggaatcttcggctgtgggat
atccgcagtgggaaatgcaccacacagatagctgctcatctggatgtcacctcggtctgc
gtgtcacggagcaggaattttgttcttacaagtgggagagataacgtgcacaaccttttt
gatgttagaacgctggagatttgtggaacattcagggccatgggcaacagagtggtgagc
agctggggcaaaccttctattagccctgacgagaactgcatcgctgctggttcttctgat
ggatctgtttacatatggtcgaggctgaagaatggaacgccgaccatcctagagggtggt
cattcttcgcccgtcctggcaagtgcatggtgcggactaggagctcttgctacctccgac
aggaaccatatctatatctggtcttga

DBGET integrated database retrieval system