KEGG   Zea mays (maize): 100283329Help
Entry
100283329         CDS       T01088                                 

Definition
(RefSeq) succinyl-CoA ligase alpha-chain 2
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
zma  Zea mays (maize)
Pathway
zma00020  Citrate cycle (TCA cycle)
zma00640  Propanoate metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100283329
   00640 Propanoate metabolism
    100283329
Enzymes [BR:zma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100283329
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100283329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 100283329
NCBI-ProteinID: NP_001149702
UniProt: B6TH57 A0A3L6FSD9
Position
2
AA seq 331 aa AA seqDB search
MAASSPRALQSLGSAASRFLHARGFAAAAAAAPSPAVFVDKSTRVICQGITGKNGTFHTE
QAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANATVIYVPPPFAAAAIMEAM
EAELDLAVCITEGIPQHDMVKVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKP
GRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIV
LIGEIGGTAEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIK
ALREAGVTVVESPAKIGSTMFEIFKQRGMVE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcctccccccgcgcgttgcaatcgctggggtccgccgcctcccgcttcctc
cacgcgcggggcttcgccgcggcggccgccgccgcgccctcgccggcggtcttcgtcgac
aagagcacccgcgtgatctgtcagggcatcacggggaagaacggcaccttccacaccgag
caggccatcgagtacggcaccaacatggttggtggagtgactcctaagaaaggtggaact
gaacatttagggctcccagtgtttaactctgtagcagaagctaaggctgaaacaaaagcc
aatgcaactgttatatatgttccaccaccatttgccgccgccgctataatggaggcaatg
gaggctgagctcgaccttgccgtctgcattacagaaggaatacctcagcatgacatggtg
aaagtgaaggctgcactaaacagccagtctaaaactcgattgattgggccaaattgccct
ggtatcattaagcctggtgagtgtaaaattggaatcatgccaggttacatccacaagcct
gggcgtattgggatcgtatctcgttctggtactttgacatatgaagcggtgtttcaaaca
acagctgtaggattgggtcagtcaacttgtgtaggcattggtggtgacccgttcaacggc
acaaattttgttgattgccttgaaaagttcgttaacgaccctcagacagaaggtattgtt
ctcattggtgaaattggaggtacggctgaggaggatgctgcgacattcatccaggaaagc
aaaacacaaaagcctgttgttgcattcattgctggacttacggcacccccgggccgtcgc
atgggtcatgctggagctatcgtggcaggaggaaagggtactgcccaggacaaaatcaag
gcactcagagaggcaggtgttaccgttgtcgagtcaccagcgaagattggctctaccatg
tttgaaatcttcaagcagcgtggaatggtagaatag

DBGET integrated database retrieval system