KEGG   Zea mays (maize): 100283483Help
Entry
100283483         CDS       T01088                                 

Gene name
pco103361
Definition
(RefSeq) uncharacterized protein LOC100283483
  KO
K06634  cyclin H
Organism
zma  Zea mays (maize)
Pathway
zma03022  Basal transcription factors
zma03420  Nucleotide excision repair
Module
zma_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100283483 (pco103361)
  Replication and repair
   03420 Nucleotide excision repair
    100283483 (pco103361)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100283483 (pco103361)
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100283483 (pco103361)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB RB_B NMT_C
Motif
Other DBs
NCBI-GeneID: 100283483
NCBI-ProteinID: NP_001149855
UniProt: B6TIT4
Position
1
AA seq 329 aa AA seqDB search
MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLNVDLLDGSVSYPESMPD
HVEGSSVVKPLSYEEEQLTRVFYEQKIQEVCAAFKFPHKIQATAIIYFKRFYLQWSVMEH
QPKHIMLTCVYASCKVEENHVSAEELGKGIQQDHQIILNNEMILLKTLDFDLIVYAPYRS
IEGFIDDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSND
LLRVVDFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCW
DPSSHDEHNKKKEKKLKHKSKRTSTDAQL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttccggacctccacccaacgggagaggtggatcttccagtcgcacgatttg
atggagaggtgggcggcggcaaaccagcgggccgctcagacccttgcgcagtatgggacg
acccggcttaatgtggacctgcttgatggctcggtatcctacccagagtccatgccggat
catgttgagggtagctcggttgtaaagcctctttcttacgaagaggagcaattgacaagg
gtattttacgagcagaagattcaggaagtatgcgctgcattcaagttccctcacaaaatc
caggctacagcaataatatatttcaagagattctatctacaatggtctgtaatggagcat
caaccaaagcatattatgttaacatgtgtatatgcttcttgcaaagtggaagaaaaccat
gtttctgctgaggaacttggtaaaggaattcagcaggaccaccagatcattctaaataat
gagatgattcttcttaaaactttagattttgatctcattgtttatgctccatatcgatcg
attgaaggatttattgatgacctagaggatttctgcagggcaggtaatggtccattccag
cgtttgaaggagttgcgccaggctgctatatcccatgttgacaaaatgatgttgactgat
gcacctcttctctatacccctgggcagttggcactggcggctcttcacaagtctaatgat
cttctcagggtcgtcgattttgaaagatacttggaaattatcttctcaaggcaacattct
gattgtccaatcgaacagtttgttcagtcgatcaacgaaatcaattacttagtcgaccag
cttaatatacctactgtcaaagacatgagacacgtggaccgcaagctgaaacattgctgg
gatccaagctcacatgacgagcataacaagaagaaagaaaagaagttaaagcacaaatcg
aaaagaacatctaccgatgcccaactatag

DBGET integrated database retrieval system