KEGG   Zea mays (maize): 100284837Help
Entry
100284837         CDS       T01088                                 

Definition
(RefSeq) quinone oxidoreductase-like protein At1g23740
  KO
K18980  2-methylene-furan-3-one reductase [EC:1.3.1.105]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100284837
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.105  2-methylene-furan-3-one reductase
     100284837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N TrkA_N ADH_N_2
Motif
Other DBs
NCBI-GeneID: 100284837
NCBI-ProteinID: NP_001151204
UniProt: B6TXY3
Position
1
AA seq 386 aa AA seqDB search
MHAFLSSSIPATSYSRSYFLPRPPQAPVKLVVPSSAPRVAAGRRTASEAGRSGRCVVAVS
ASSSPATAAVATEVPGVMKAWVYDAYGDAGVLKLDEAAAVPAVGEDQVLVKVVAAALNPV
DAKRRAGKFQATDSPLPTVPGYDLSGVVVKVGSQVKKLKEGDEVYGMVSENPLQGPKQSG
SLAEYTAVEEKLLALKPKGLDFAQAASLPLAVETANEGLERAGISAGKSVLILGGAGGVG
SLAIQLAKHVYGASKVAATASTKKIELLKSLGADVAIDYTKENLEELPDKYDIVFDGVGQ
GDKAVKVVKEGGSVVVLTGAVSPPGFRFVVTSNGSVLEKLNPYLESGKLKPLIDPEGPFS
FSQVVEAFSYLETGRATGKVVISPIP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgttcctctcttcgtcgatcccggccacttcgtactcgagatcatacttcttg
ccgcggccgcctcaggctcccgtgaagctcgtcgtcccgtcgtcagcgccgagggtcgcc
gccggtagaagaacagcttcggaagctggtcggtcgggacggtgcgtcgtcgcggtgtcc
gcgtcctcgtccccggccacggccgcggtggcgacggaggtgcccggggtgatgaaggcc
tgggtgtacgacgcgtacggggacgccggcgtgctcaagctcgacgaggccgcggctgtg
ccggccgtgggcgaggaccaggtgctcgtcaaggtcgtcgccgcggcgctcaaccccgtc
gatgccaagcggcgggccggcaagttccaggccaccgactcccctctcccgaccgtgccg
gggtacgacttgtccggcgtcgtcgtcaaggtgggcagccaggtgaagaagttgaaggaa
ggcgacgaggtgtacggcatggtcagcgagaatccgctgcaggggcccaagcagtccggc
tcgctggcggaatacaccgccgtcgaggagaagctgctggcgctcaagcccaagggcctc
gacttcgcgcaggccgccagcctgccgctagccgtcgagaccgccaacgagggcctggag
agggcaggaatatccgccggcaagtccgtcctcatcctcggtggcgccggcggtgtcggc
tcccttgcgatccagctagcgaagcatgtctacggcgcgtccaaggtagctgcgacggcc
agcaccaagaagatcgagctgctcaagagcctaggtgccgatgtcgccatcgactacact
aaggagaacttggaagagctaccggacaaatacgacattgtcttcgacggagtcggtcag
ggtgacaaagctgtcaaggtagtgaaggaaggcggcagcgtggtggttctcaccggcgcc
gtcagccctccagggttccggttcgtcgtcacctccaacggctccgtcttggagaagctc
aacccgtacctcgagtcagggaagctgaagccactcatcgacccggaggggcccttctcc
ttctcgcaggttgtggaggcgttctcctaccttgagaccgggagggcaaccggcaaagta
gtcatctctcccatcccatga

DBGET integrated database retrieval system