KEGG   Zea mays (maize): 100285944Help
Entry
100285944         CDS       T01088                                 

Definition
(RefSeq) glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
zma  Zea mays (maize)
Pathway
zma00970  Aminoacyl-tRNA biosynthesis
zma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100285944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zma01007]
    100285944
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:zma03016]
    100285944
Enzymes [BR:zma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     100285944
Amino acid related enzymes [BR:zma01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   100285944
Transfer RNA biogenesis [BR:zma03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100285944
 Prokaryotic type
   Other AARSs
    100285944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Motif
Other DBs
NCBI-GeneID: 100285944
NCBI-ProteinID: NP_001152305
UniProt: A0A3L6DJ75 B6UC34
Position
8
AA seq 796 aa AA seqDB search
MGTGGDGSKAGPALPLEALLALGLDQRTAENALVNAKVTANLASVIAEAGIKECDKSVGN
LLYAVATKYPTNALVHRPVLISYVLSTKIKNPAQLDAALSFLTNTGPDSLDVVKFEEACG
VGVVVSIEEIKSTVTDVLEENMEAIKEQRYHINVGTLCGQVRKRHPWGDAKAIKEEIDKR
LAEILGPKTEADNIKPVKKKKEKPAKVEEKKVAVATAAPPSEEELNPYTIFPQPEENFKV
HTEIFFSDGNIWRAHNTKEILEKHLKATGGKVMTRFPPEPNGYLHIGHAKAMFIDFGLAK
ERNGHCYLRFDDTNPEAEKKEYIDHIQEIVHWMGWEPYKVTYTSDYFQALYEHAVELIQK
GLAYVDHQTAEEIKEYREKKMDSPWRGRPIEESLKLFEDMRRGLIAEGAATLRMKQDMQN
ENKNMSDLIAYRIKFTPHPHAGDKWCVYPSYDYAHCMVDSLENITHSLCTLEFDIRRPSY
YWLLVALGLYQPYVWEYSRLNISNTVMSKRKLNRLVTEKWVDGWDDPRLLTLAGLRRRGV
SSTAINSFIRGIGITRSDNSLIRVDRLEYHIREELNKTAPRTMVVLRPLKVVITNLEEGK
VLDLDGKMWPDASDTDASSHYKVPFSRTVYIEKTDFRLKDSKDYYGLAPGKSVMLRYAFP
IKCTDVISGDSPDDIVEIRAEYDPLKTSKLKGVLHWIAEPAPGVEPLKVEVRLFEKLFMS
ENPAELEDWLGDLNPHSKEVIKDAYAVPSLATAVLGDKFQFERLGYFAVDTDSTPEKLVF
NRTVTLRDSFGKAGPK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgggggagacgggagcaaggcgggcccggcgctgccgctggaggcgctgctg
gcgctcggcctcgaccagcgcaccgccgagaacgcgctcgtcaacgccaaggtcaccgcc
aacctcgcctccgtcatagccgaggctggtataaaggaatgcgacaagtcagtcggcaat
cttctgtatgcagtcgccaccaagtacccaactaatgcacttgttcaccgtcctgtcctt
attagctatgtcttgtcaacaaagataaagaaccccgcacagctagatgctgctctgtca
tttcttactaatactggtcctgattctctagatgtggttaaatttgaagaagcatgtggt
gtaggtgtggttgtttctattgaggaaattaaatctactgttactgatgtgcttgaggag
aatatggaagctataaaggagcagcgatatcacataaatgttggtacactatgcggacag
gtcaggaagagacacccctggggtgatgctaaggcgataaaggaggaaattgacaagagg
cttgcagaaatcctaggtcccaagacagaagctgacaatataaaaccagtgaaaaagaag
aaggaaaaaccagcaaaagttgaggagaaaaaagttgcagttgccactgctgccccacca
tctgaggaggaattgaacccgtacactatatttccccaaccagaggaaaacttcaaggtt
catacagaaatatttttcagtgatgggaacatatggagagcgcataacacaaaggaaatt
ttagaaaaacatcttaaagcaactggaggaaaagtgatgacccgttttccaccagaacct
aatggatatcttcatattggtcatgccaaggctatgtttattgattttggtctggctaag
gagcgaaatggccattgctaccttagatttgatgacacaaatccagaagctgaaaagaaa
gaatacatagatcacattcaggaaatcgtccattggatgggatgggagccctacaaagta
acatacacgagtgactatttccaagctttgtatgaacatgccgttgagttaatacagaaa
gggctagcatatgtggatcaccagactgcagaagaaatcaaggaatacagggaaaagaag
atggatagtccatggaggggtaggccaattgaagagtctctgaaattatttgaagacatg
aggcgtgggttgattgcagagggtgcagcaactctccgtatgaagcaggatatgcaaaat
gagaacaaaaatatgtctgacttaatagcatatagaataaaattcaccccccatccacat
gctggcgacaagtggtgtgtctatccgagctatgactacgctcattgcatggtggattct
cttgaaaacatcacacattcgctgtgcacacttgagtttgacatacgtcgcccttcatac
tactggctacttgttgccttgggcctttatcaaccatatgtgtgggaatattcgaggcta
aacatatcaaatactgtgatgtctaaaagaaagttgaatcgacttgtgacagagaagtgg
gtagatgggtgggatgatccccgcttgttgacactggctggtctccggcgacggggagta
tcatcaactgcaataaattcctttattcgtggaatcgggataacgagaagtgacaatagc
ttaattcgtgttgatcgtctagaatatcacatcagggaggagcttaacaaaacagcccct
cgaaccatggttgttttgcgacctctaaaggtggtaataactaacttggaagaaggaaaa
gtactagaccttgatggcaaaatgtggcctgatgcttctgatactgatgcttcctcccac
tataaggttccgttctcaagaactgtctacattgagaaaactgattttcgcctaaaggac
tcaaaagactactatgggctagcccctggtaaatctgtcatgctaaggtatgcgttcccc
ataaaatgcacagatgttatctctggtgatagtcctgatgatattgttgaaattcgagct
gaatatgatcctttgaagacttctaaactgaagggtgttcttcactggattgctgagcca
gcacctggtgtagagccattgaaggtggaagtaagattattcgagaaattgttcatgtca
gagaatcctgctgaattggaagattggcttggcgatcttaacccacactcgaaagaggtg
ataaaggatgcttatgctgtaccatcacttgccactgcggttctgggtgacaagttccag
tttgagcggcttggttacttcgccgtggatactgactccacacctgagaaactcgtgttc
aacagaactgttaccctccgtgattcgttcgggaaagctggacccaagtga

DBGET integrated database retrieval system