KEGG   Zea mays (maize): 100286141Help
Entry
100286141         CDS       T01088                                 

Definition
(RefSeq) retrotransposon protein SINE subclass precursor
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:zma01002]
    100286141
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     100286141
Peptidases and inhibitors [BR:zma01002]
 Aspartic peptidases
  Family A1: pepsin family
   100286141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 TAXi_C DHQ_synthase Asp_protease_2
Motif
Other DBs
NCBI-GeneID: 100286141
NCBI-ProteinID: NP_001152501
UniProt: B6T9S6
Position
8
AA seq 504 aa AA seqDB search
MGQTHLLLLACFWVLSTCSLLLDASSDGLLRINLNKKRLDKEALTAAKLAKKESNLRRSV
GADQYLSASTDDIVPLDNYLDTQYFGQISIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIA
CYLHHRYKSTKSKTYTKNGESCTITYGSGQIAGFFSEDNVLVGNLVVQNQKFIETTRETS
PTFIIGKFDGILGLGFPEISVGGAPPIWQSMKQQKLVAKDVFSFWLNRDPDASSGGGELV
FGGVDPKHYKGDHTYVPVTRKGYWQFDMGDLIIGGHSTGFCAGGCAAIVDSGTSLLAGPT
TIVAQVNHAIGAEGIISTECKEVVSEYGEMILELLISQTSPQKVCTQIGLCVFDGAHSVS
NPIESVVEKQKRGSDLFCTACEMAVVWIQNQLRENKTKELILNYANQLCERLPSPNGEST
VDCHQISKMPNLAFTIANKTFTLTPEQYIVKLEQAGQTICISGFMAFDVPPPRGPLWILG
DVFMGAYHTVFDFGENRIGFAKSA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggggcagacgcatcttttgttgctcgcttgtttctgggtcctgtcaacatgctccttg
ctacttgatgcttcctccgatggactgttaagaatcaacctgaacaagaagagactggac
aaggaagctttgactgctgcgaaattggcgaagaaggagagcaaccttcgaaggtctgtg
ggtgctgaccagtatctcagtgcctcaactgatgacatagtccctttggacaactacctg
gacacccagtactttggacagatcagcatcggcacgccaccacagaacttcacagtgata
ttcgacactggaagctccaacttgtgggttccctcatccaagtgctacttttcgatagca
tgctacttacaccacagatacaagtcaaccaagtcgaagacttacacaaagaatggagaa
tcttgtacgataacatatggttctgggcaaatcgctggcttcttcagtgaggacaatgtg
ttggttggcaaccttgttgtgcaaaatcagaaatttattgagacaactcgagaaaccagc
cctactttcatcattgggaagtttgatggaattcttggtctcggatttcctgaaatttct
gtaggaggagcccctccaatttggcagagcatgaaacagcagaaactggtcgcaaaggat
gtcttctctttctggcttaatcgtgaccctgatgcatcttctggaggaggcgagcttgtc
tttggtggtgttgacccaaaacactacaaaggggaccatacatatgttcccgttacacgc
aaaggctactggcagtttgacatgggagatcttattattggtggccactcaactggtttc
tgtgctggtggctgtgctgctattgtggactcagggacttcattgcttgctggtccaact
accatagtggctcaagtcaatcatgcaattggggctgagggaatcatcagtacagaatgc
aaagaagtggtgagcgagtatggagagatgatccttgagttgctcatatcgcagacaagc
ccacagaaagtgtgcactcagattggtctctgtgtatttgatggtgcccattctgtcagc
aatccaattgaatctgttgttgagaaacagaagcgtggttctgatcttttctgtactgct
tgtgagatggctgttgtctggatacagaatcagctccgtgaaaacaagacaaaagaactc
attttgaattatgctaatcagctctgtgagcgtctccctagccccaatggcgagtcaact
gttgattgccatcagatctcaaagatgccaaatcttgcattcaccatagcaaacaagact
ttcaccttaacaccagagcagtacatagtgaagctggagcaagcaggacaaactatctgc
atcagtgggtttatggcatttgacgtaccgcctcctcgtggtcctctctggatacttggt
gatgtttttatgggtgcctaccacactgtttttgacttcggtgagaacaggattgggttt
gccaaatctgcatga

DBGET integrated database retrieval system