KEGG   Zea mays (maize): 100286168Help
Entry
100286168         CDS       T01088                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
zma  Zea mays (maize)
Pathway
zma03040  Spliceosome
zma04141  Protein processing in endoplasmic reticulum
zma04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100286168
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100286168
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100286168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zma01009]
    100286168
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zma03041]
    100286168
   03009 Ribosome biogenesis [BR:zma03009]
    100286168
   03110 Chaperones and folding catalysts [BR:zma03110]
    100286168
   04131 Membrane trafficking [BR:zma04131]
    100286168
   03051 Proteasome [BR:zma03051]
    100286168
   03029 Mitochondrial biogenesis [BR:zma03029]
    100286168
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zma04147]
    100286168
Protein phosphatases and associated proteins [BR:zma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100286168
Spliceosome [BR:zma03041]
 Complex B
  Other components
   Prp19 complex
    100286168
 Complex C
   Prp19-CDC5 complex
    100286168
Ribosome biogenesis [BR:zma03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100286168
Chaperones and folding catalysts [BR:zma03110]
 Heat shock proteins
  HSP70 / DNAK
   100286168
Membrane trafficking [BR:zma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100286168
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100286168
Proteasome [BR:zma03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100286168
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100286168
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   100286168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA DUF5398 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 100286168
NCBI-ProteinID: NP_001152528
UniProt: B6UFB3 A0A3L6G9D8
Position
10
AA seq 703 aa AA seqDB search
MVSFTCSQVGATAAGGASPFIGYRWRSGPGGATPSSSLFVGRRLAAVQMRAPSRGARGGS
ALRVTCEKVVGIDLGTTNSAVAAMEGGKPTVVTNAEGARTTPSVVAYTKTGERLVGQIAK
RQAVVNPENTFFSVKRFIGRKMAEVDDEAKQVSYGVVKDENGNVKLDCPAIGKQFAAEEI
SAQVLRKLVDDASKFLNEKITKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAA
SLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWL
ASNFKKDERIDLLKDKQALQRLTEAAEKAKMELSTLTQANISLPFITATADGPKHIEATL
SRAKFEELCSDLIDRLKTPVNNALRDAKLSLSDLDEVILVGGSTRIPAVQELVRKLTDKD
PNVTVNPDEVVSLGAAVQGGVLAGDVKDVVLLDVTPLSLGLETLGGVMTKIIPRNTTLPT
SKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDA
NGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAKEDKEKRDAIDTKNQAD
SVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAISGGSTQSMKDAMAALNQEVMQIGQ
AMYNQPGASAAGPTPGAEAGPTPGTGPTQNDGDVIDADFTDSN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggtctccttcacctgttcccaggtcggcgcgacggcagcgggcggagcctcgcccttc
atcggctaccggtggcggagcggccccgggggagccactccgtcgagctccctcttcgtt
ggccggcggctggcagcggtgcagatgcgcgcgccatctcgcggggcccgcgggggctcc
gcgctgcgggtcacgtgcgagaaggtggtggggatcgacctgggcaccaccaactccgcg
gtcgccgccatggagggcggcaagccgaccgtcgtcaccaacgccgagggcgcgcgcacc
acgccttccgtggtggcgtacaccaagaccggggagcgcctggtggggcagattgctaag
cgccaggcggtcgtgaaccccgagaacaccttcttctctgtcaagcgcttcatcggccgc
aagatggctgaggtcgacgacgaggccaagcaggtctcgtacggcgttgtcaaggacgag
aacggcaacgtcaagctcgactgccccgctatcggcaaacagttcgctgccgaggagatc
tccgcgcaggttttgaggaagttggtggatgatgcatctaagtttcttaatgagaaaatc
acaaaagcagtggttacagtcccagcatatttcaatgattcacaaaggacagcaactaaa
gatgctggccgcattgcaggactggaagttctccgtattattaatgaaccaactgctgca
tcgttggcctatggtttcgagaagaaaaataatgaaacaattctagtgtttgatttggga
ggcggaacctttgatgtatctgtattggaagttggtgatggtgtgtttgaggtgctttcc
acatctggtgacacacaccttggtggtgatgacttcgataagagaatagtagattggctt
gctagcaacttcaagaaagatgaacgtattgatcttctgaaggataaacaagcccttcag
aggcttactgaggcagcagagaaagctaagatggaactgtcaacgctgacacaggcaaat
attagcctaccattcattactgctactgctgatgggccaaaacacatcgaggcaaccctc
tcgagagccaaattcgaggaactatgttcagaccttatagacaggcttaaaactcctgtt
aataatgcactgagagatgccaagttgtctctcagtgatctggatgaagttattcttgtg
ggtggatccacccgaatccctgcagttcaagaacttgtgaggaagcttactgacaaggat
cccaatgttacggtcaaccctgatgaggttgtttctcttggggcagctgtgcagggcggg
gttttggcaggagatgtgaaagatgtcgttcttctggatgttactccattatctcttggt
ttggagacattgggtggagtgatgacaaagattatccccaggaataccacactgccaacc
tcaaaatcggaggtattctcaacagctgcagatggacagacgagcgttgagattaatgtt
ctccagggagaaagagagtttgttagggacaacaagtcccttggaagcttccggttggac
ggaatccctcctgcacctcgtggtgtcccacaaattgaagtgaagtttgatattgatgca
aatggtatcctctcagttgctgccattgataagggcactggaaagaaacaggacatcacc
atcactggtgctagtacgctacctaaggatgaggttgagagaatggtagaagaagccgat
aagtttgccaaggaggacaaagagaagagagatgcaatcgacaccaaaaaccaggcggac
tcagtggtctaccagactgagaagcaactgaaggagcttggcgacaaagtccccgctcct
gtgaaagagaaggtggatgtgaagctccaggagctcaaagacgccatttctggtggatca
acacagagtatgaaagatgccatggctgctctgaaccaggaggtgatgcagattggccag
gcaatgtataaccagcctggtgccagtgctgctgggcctactcctggtgctgaggccgga
cctacgcctggtaccggaccaacgcagaatgatggggatgtcattgacgcagacttcaca
gatagcaattga

DBGET integrated database retrieval system