KEGG   Zea mays (maize): 100286267Help
Entry
100286267         CDS       T01088                                 

Definition
(RefSeq) rae1-like protein
  KO
K14298  mRNA export factor
Organism
zma  Zea mays (maize)
Pathway
zma03013  RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100286267
Messenger RNA biogenesis [BR:zma03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100286267
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100286267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 100286267
NCBI-ProteinID: NP_001152626
UniProt: B6UGZ9
Position
3
AA seq 345 aa AA seqDB search
MASFNPAGASAANHNPNKSFEVTPAPGDSVSSLSFSPKANHLVATSWDNQVRCWEVMAGG
ACQAKASISHDQPVLCSAWKDDGLTVFSGGCDKQVKMWPLLSGAQPTVFSGHEAPIKELA
WVPQMNLLVSGSWDKTLRYWDIRQPQPVHVQQLPERCYALSLCYPLMVVGTADRNVIVFN
LQNPQAEFKRITSPLKLQTRCLAAFPDQQGFLIGSIEGRVGVHHVEESQQGKNFTFKCHR
DGNDIYAISSLNFHPVHGTFATTGSDGSFNFWDKDSKQRLKAYNRCPSPITCSAFNHDGS
IFAYAVCYDWSKGAEKHNPSTAKTNIFLHSAQDSDVKGKPRAGKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcttcaatcccgccggcgccagcgccgccaaccataatcccaacaaatccttc
gaggtgactccggcgcctggggactcggtgtccagcctcagcttcagccccaaggcgaac
cacctcgttgccacctcatgggacaaccaggttcggtgctgggaggtcatggctggtggg
gcctgccaagcgaaggcctccatttcgcacgatcaaccggtgctgtgctcggcttggaag
gatgatgggttgactgttttctcaggaggctgtgataagcaggttaaaatgtggcccctg
ctctcaggtgcccagcccacggttttctcaggccatgaggcacctattaaagaactcgct
tgggtgccacagatgaatcttcttgtcagtgggagctgggacaagactttgaggtactgg
gacattaggcaaccccaaccagtgcatgttcagcaacttcctgagcgttgctatgctcta
tcgctttgttatcctctcatggtggttggcactgctgatcgcaacgtaatagtcttcaat
ctgcagaatccacaggctgaattcaagaggattacgtcacctttgaagctccagacaagg
tgtcttgctgcatttcctgatcaacaaggttttttgattgggtctatagaaggacgagtt
ggtgttcatcatgtggaagagtctcagcaaggaaaaaactttacattcaagtgtcaccgc
gatggcaatgatatatacgctattagctcgttgaactttcatcctgtgcatggtacattc
gctactacaggctctgatggaagtttcaacttttgggataaggacagtaagcaaaggctg
aaggcttataataggtgtccatcccccatcacatgcagcgcattcaatcatgatggctct
atatttgcttacgcggtatgttatgattggagcaaaggtgctgagaagcataatccttct
actgcaaagacaaatatatttctacatagtgcacaggattctgacgtgaaaggaaaaccc
cgcgctggaaagaagtag

DBGET integrated database retrieval system