KEGG   Zea mays (maize): 100304345Help
Entry
100304345         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100304345
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    100304345
Membrane trafficking [BR:zma04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    100304345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 zf-RING_2 Pox_Ag35
Motif
Other DBs
NCBI-GeneID: 100304345
NCBI-ProteinID: NP_001334065
UniProt: A0A1D6DTP0 C0HF00
Position
2
AA seq 954 aa AA seqDB search
MSTAPARRARPPLPLQNGAEGDDEREEEVDEEEVGDDEAEEEEDDDDEEEPRLKYQRLGG
SVPAILSTDAAAAIAVADRMVALGTHNGTLHILDFQGNQVKEIAAHTATINDISFDADGE
YIGSCSDDGTVAINSLFTDEKLKFEYHRPMKAIALDPNYARNYRRFATGGLAGQVLVLTK
KSWGGYHKKVLRDGEGPIHSMKWRADLLAWANDAGVKVHDMRTDKGIAFIERPKGIHRPE
FLLPHLVWQDDTVLVVGWGTSVKIAAIRTDLSQGLNGLQRTITTASSEKYVDIVGSFQTG
YHISGVAPFGDLLVVLAYIPDEDEKEKTFSTSVTSRQGTAQRPEIHLVSWKNDELTTDAL
PIHGYEHYKAKDYALAHAPFSGSSNAGGQWAAGDEPLYYIVSPKDIVVAKPRDAEDHIAW
LLQHGCHEKALAAVEAGQGRTELLDEVGSRYLDHLIIERKYAEAAQRCPKLLRGSPSAWE
RWVFHFAHLRQLPVLVPYIPTENPQLSDTAYEVALVALTTNPSFHELLLTTIKNWPPTLY
SASPVISAIEPQLNSSSMADSLKESLAELYVINGQYEKALSLYAELLKPEVFEFIEKYNL
HDAIHDKIVNLMIVDNKRTVHLLIQHRDIIPPYEVVEQLLHTSKKCDKRYLLHLYLHALF
EIDIHAGKDFHDMQVELYADYETRMLLPFLRTSQHYRLDKAYEIFAQKELVREQVFVLGR
MGNAKEALSTIINKLEDMQEAVEFVTEQHDDELWEELIRQCLQKPEMVGNLLEHTVGNLD
PLYIVSLVPDGLEIPRLRDRLVKIVTDYRTETSLRNGCNDILKADCVNLLVKYYHEARRG
VYMVSMDEEVHGNRADDGSSRGHERSSSVRALDIKSRTRCGARCCLCFDPLPIQDISVIV
FYCCHAYHLSCLEGGLDSMRSNSGQDSDGGMDDEDGSPSGQSRMRCVLCTTAAS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgcgcccgcgcggcgcgcccgcccgccgctgccgctgcagaacggcgcggag
ggcgacgacgagcgcgaggaggaggttgatgaggaggaagtgggcgatgacgaagcggag
gaggaggaggacgacgacgacgaggaggagccgcggctcaagtaccagcggctaggcggg
agcgtgccggcgatcctctccaccgacgccgcggccgccatcgccgtcgccgaccgcatg
gtcgcgctcggcactcacaacggcacgctccacatcctcgacttccagggcaaccaggtg
aaagaaattgctgcgcacacagcaactatcaacgacataagctttgacgcagacggtgaa
tatataggcagctgctcggatgatggcacagtggcaataaacagcctcttcaccgatgaa
aagctaaagtttgagtaccatcgccccatgaaggcaattgctctagaccctaattatgcc
cggaactatagaagatttgctactggtggtttagcaggccaagtacttgtgctgacaaag
aagtcttggggaggttaccataagaaggttttgcgtgatggtgaagggccaatccattcg
atgaagtggagggcggatcttcttgcttgggctaatgatgcaggggtcaaagtgcatgat
atgagaacagacaaagggatcgcattcatagagagaccaaaaggcattcatcgaccagag
ttcttgcttccccacctagtctggcaggatgatacagtcttagttgttggatggggaaca
agtgtcaagattgcagcgatccgaacagatctatctcagggactcaatggcctacaaaga
actatcaccacagctagttctgagaagtatgtggacattgtgggctcattccaaacaggc
tatcacatatctggggttgctccatttggtgaccttttagtcgtacttgcctatattcct
gatgaggatgaaaaagagaaaacatttagtacttctgttacttcacgacagggaactgca
cagcgtccagaaatacatcttgtatcatggaaaaatgatgagcttactacagatgctctg
cctattcatggttatgagcattacaaggcaaaggactatgctcttgcacatgcacctttc
tcaggaagtagcaatgcaggtggacagtgggctgctggtgatgaacctttgtattacatt
gtgtctcctaaggacatagtcgttgcaaagccaagagatgctgaagatcatattgcttgg
cttcttcaacatggttgccatgaaaaagcattggctgcagttgaggcagggcaaggacgc
actgagcttcttgatgaggtgggctcaagataccttgatcacttgataattgaaagaaaa
tatgctgaagctgctcaacgctgcccaaagttgttgcgaggatccccttcagcatgggag
agatgggtcttccactttgctcatctccgccaacttcctgttttggtcccttatattcct
acagaaaatcctcagctgagtgatactgcatatgaggttgcccttgttgctctaactacc
aatccttctttccatgaacttctcttgactactataaaaaattggccaccgacattatac
tcagcctcaccggtcatatctgccattgagccacagctaaactcctcatcgatggctgat
tcattgaaagagtcattagctgaattgtatgtgatcaatggtcaatacgaaaaggcactt
tctctttatgctgaactcctgaagccagaagtattcgagtttattgagaaatacaacttg
catgatgccattcatgataagattgtcaatcttatgatagtggacaataaaagaacagtt
cacctactgatccaacatcgtgatatcattcccccatatgaagttgtggagcagctgttg
cataccagtaaaaaatgtgacaagagatatttgttacacctgtatttgcatgctttattt
gagatagatatacacgctggaaaggattttcatgatatgcaggtggagctttatgctgac
tacgagacaaggatgctactacccttccttcgaaccagtcagcattacaggcttgacaag
gcatatgaaatctttgcacaaaaagaacttgtaagggagcaagtttttgtccttggtcga
atgggcaatgctaaggaagctctgtcgacaattataaacaaactggaagacatgcaggag
gctgttgaatttgttacggaacagcatgatgatgaactgtgggaggaactgattagacaa
tgcctccagaagcctgaaatggtagggaatctattggaacatacagttggcaatcttgat
cctctgtacattgtcagtttggttcctgatggcttagaaatacctcggttgcgggatcgt
cttgtgaaaattgtgacggattaccggacagaaacttcattgcgaaatggatgcaacgat
atacttaaggctgactgtgttaaccttttggttaaatactaccacgaggctcggcgtggg
gtatacatggtaagcatggacgaggaggtacacggaaacagagctgacgatggatcatcg
cggggacacgagagatcatctagcgtccgggctctagatatcaagtccagaacaagatgt
ggtgcccggtgttgtttgtgcttcgatcctttgcctatccaggacatatctgtcatcgtg
ttctactgctgccatgcgtatcatctgtcttgccttgaaggtggcttagactcgatgaga
tcaaacagtggtcaggatagtgacggaggcatggacgatgaggatggttccccatcaggc
cagtctcgcatgcgctgtgtcttgtgcactactgctgcttcataa

DBGET integrated database retrieval system