KEGG   Zea mays (maize): 100501536Help
Entry
100501536         CDS       T01088                                 

Definition
(RefSeq) heat shock protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
zma  Zea mays (maize)
Pathway
zma03040  Spliceosome
zma04141  Protein processing in endoplasmic reticulum
zma04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100501536
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100501536
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100501536
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zma01009]
    100501536
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zma03041]
    100501536
   03009 Ribosome biogenesis [BR:zma03009]
    100501536
   03110 Chaperones and folding catalysts [BR:zma03110]
    100501536
   04131 Membrane trafficking [BR:zma04131]
    100501536
   03051 Proteasome [BR:zma03051]
    100501536
   03029 Mitochondrial biogenesis [BR:zma03029]
    100501536
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zma04147]
    100501536
Protein phosphatases and associated proteins [BR:zma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100501536
Spliceosome [BR:zma03041]
 Complex B
  Other components
   Prp19 complex
    100501536
 Complex C
   Prp19-CDC5 complex
    100501536
Ribosome biogenesis [BR:zma03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100501536
Chaperones and folding catalysts [BR:zma03110]
 Heat shock proteins
  HSP70 / DNAK
   100501536
Membrane trafficking [BR:zma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100501536
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100501536
Proteasome [BR:zma03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100501536
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100501536
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   100501536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 100501536
NCBI-ProteinID: NP_001183165
UniProt: C4J410
Position
8
AA seq 648 aa AA seqDB search
MAKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAE
EISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPT
AAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYS
TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIT
VTFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEVKKK
VDAKNALENYAYNMRNTIKDDKIASKLPAEDKKKIEDAVDGAISWLDSNQLAEVEEFEDK
MKELEGICNPIIAKMYQGEGAGMGAAAGMDEDAPSGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagcgagggtccggcgatcgggatcgacctcggcaccacctactcgtgcgtc
ggcgtgtggcagcacgaccgggtggagatcatcgccaacgaccaggggaaccgcaccacg
ccgtcctatgtcggcttcaccgacaccgagcggctcatcggcgacgctgccaagaaccag
gtcgccatgaaccccaccaacaccgtcttcgatgccaagcggttgatcggcaggaggttc
tctgacccgtcagtgcagagtgacatgaagctatggccgttcaaggtcatcccagggcct
ggtgacaaacccatgattgtagtcaactacaagggcgaggagaagcagtttgctgctgag
gagatctcctccatggtcctcatcaagatgaaggagattgctgaagcctaccttggttcc
accatcaagaacgcagtggtgacagtgccggcctatttcaacgactcgcagaggcaggcc
accaaggacgccggtgtcattgcgggcctcaatgtgatgcgtatcatcaacgagcccact
gctgctgctattgcctacggtcttgacaagaaggccaccagctccggcgagaagaacgtg
ctcatcttcgaccttggtggtggcacgtttgatgtgtcgctcctcaccatcgaggagggc
atcttcgaggtgaaggccactgcgggcgacactcaccttggcggcgaggacttcgacaat
cgcatggtgaaccacttcgtccaagagttcaagcgcaagaataagaaggacataagcggc
aacccccgtgcactgcgccggctgcgcacggcgtgcgagcgcgccaagcgcacgctgtca
tcgactgcccagacgaccattgagatcgactccctgttcgagggcatcgatttctactcc
acgatcaccagggctcgcttcgaggagctcaatatggacttgttccggaagtgcatggaa
cctgtggagaagtgcttgcgcgacgccaagatggacaagagcagcgtgcacgacgtcgtg
ctcgtcggtggctccacccgcatccccaaggtgcagcagctgctgcaggacttcttcaac
ggaaaggaattgtgcaagagcatcaaccccgacgaggctgtggcgtacggcgccgctgtc
caggctgccatcctcagcggcgagggcaacgaaaaggtacaagatctgctcctgctcgac
gtcacgccactgtctctcggcctggagactgcaggtggcgtcatgacggtgctgatcccg
aggaacaccaccatcccgaccaagaaggagcaggtcttctccacgtactccgacaaccag
ccgggcgtcctgatccaggtgtacgagggtgagcgcgcgaggaccaaggacaacaacctc
ctcggcaagttcgaactctccggcatccctcctgctccccgcggcgtgccccagatcacg
gttaccttcgacatcgatgccaacggcatcctcaacgtctctgccgaggacaagaccacc
ggccagaagaacaagatcacgatcaccaacgacaagggccggcttagcaaggaggagatc
gagaagatggtgcaggaggctgagaagtacaaggcagaggacgaggaggtcaagaagaag
gtggacgccaagaacgcgctcgagaattatgcctacaacatgaggaacaccatcaaggac
gacaagatcgcctccaagctccccgctgaggacaagaagaagatcgaagatgccgttgac
ggcgccatcagctggctggacagcaaccagctggctgaggtggaggagttcgaagacaag
atgaaggagcttgaggggatctgcaaccccatcatcgcgaagatgtaccagggcgagggc
gcgggcatgggcgctgctgctggcatggatgaggatgccccgtctggtgggagcggtgct
ggtcccaagatcgaggaggtggattaa

DBGET integrated database retrieval system