KEGG   Zea mays (maize): 100501555Help
Entry
100501555         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100501555
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
zma  Zea mays (maize)
Pathway
zma00940  Phenylpropanoid biosynthesis
zma00941  Flavonoid biosynthesis
zma00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    100501555
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    100501555
   00941 Flavonoid biosynthesis
    100501555
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     100501555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferase WES_acyltransf DUF3572
Motif
Other DBs
NCBI-GeneID: 100501555
NCBI-ProteinID: NP_001344644
Position
7
AA seq 444 aa AA seqDB search
MAVVEVVTSELVAPSEPTPRRPLWLSNLDLAARNGYTPTIYFFRRPQDSSDGRLRADSCF
STHALRAALAAALVRFYPFAGRLRAAGRGGRAEIDCNAAGALLVVARSAAALEDFLHDFA
PSKAMNDTFVPTYDSAGPDAPLLLLQVTFFRCGGVALGTAMHHFVIDGRSAFHFIRTWSS
IARGDTAAAPPSLDRTPLRARPLLTTAAALFDHTHEYGGRASRPAAVTAGAAAGSKAEYA
SAILRVTGAQAAALRARAGAVSTFRALVAHVWRCACAARALAHDAESRLYTMVDMRARLS
PPLPDAFFGNAVVRTSASARVGDLLANPLGFGARRLRAATGHGDEYVRSLLDYLETADLA
TVPRQGLRGTDLRVISWLGMPSYDADFGWGEPALLAPALMYYPGFVYLLNCPGKGGDVAV
AAALEPERMQRFKELFYEELAMLE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgtcgaggtcgtcacctccgagctggtggcgccgagcgagcccacgccgcgg
cgcccgctctggctgtccaacctcgacctcgccgcgcggaacggctacaccccgacgatc
tacttcttccgccgtccccaggacagcagcgacggccggctgcgtgcggactcctgcttc
tcgacccacgcgctgcgtgcggcgctggccgccgcgctggtccggttctacccgtttgcc
ggccggctccgcgccgccggccgcggcgggcgcgccgagatcgactgcaacgccgcgggc
gcgctcttggtcgtcgcgcggtccgccgcggcgctcgaggacttcctccacgacttcgcg
ccgtccaaggccatgaacgacacgttcgtgcccacgtacgactccgctggccccgacgca
ccgttgctactgcttcaggttacctttttcaggtgcggcggcgtggcgctcggcacggcg
atgcaccacttcgtcatcgacggccgcagcgccttccacttcatccgaacgtggtccagc
atcgcccgtggagacaccgccgccgcgcccccgtcgcttgaccgcacgccactccgggcg
cgcccactgctcactactgccgccgccctcttcgaccacacccacgagtacggcggccgc
gcctccaggccagcagcagtaaccgccggcgccgcggccggaagcaaggcggagtacgcc
agcgcgatcctccgcgtgaccggcgcgcaggccgccgccctgcgcgcccgcgccggcgcg
gtgtccacgttccgcgcgctggtggcgcacgtctggcggtgcgcgtgcgcggcacgcgcg
ctggctcacgacgccgagtcccgcctctacacgatggtggacatgcgcgcccgcctgtcc
ccgccgctgccggacgccttcttcggcaacgcggtggtgcgcacctccgcgtcggcccgc
gtcggcgacctcctggccaacccgctgggtttcggcgcacgtcggctccgcgcggcgacg
gggcacggggacgagtatgtgcgctcgctgctggattacctggagacggcggacctggcg
acggtaccgcgccaggggctgcgcggcacggacctgcgggtgatcagctggctggggatg
ccgtcgtacgacgccgacttcgggtggggcgagccggcgctgctggcgccggcgctcatg
tattacccggggttcgtgtacctgttgaactgccccggcaagggtggcgatgttgccgtg
gccgccgcgctggagcccgagcgcatgcagcggttcaaggagctcttctacgaggagctg
gctatgctggagtga

DBGET integrated database retrieval system