KEGG   Zea mays (maize): 103627222Help
Entry
103627222         CDS       T01088                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
zma  Zea mays (maize)
Brite
KEGG Orthology (KO) [BR:zma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103627222
Enzymes [BR:zma01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103627222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103627222
NCBI-ProteinID: XP_008645736
UniProt: B4FZZ2 A0A3L6EY34
Position
5
AA seq 172 aa AA seqDB search
MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF
HRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTAPGVLSMANAGPNTNGSQFF
ICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGSTSKVVKVADCGQLS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccctcgcgtcttcttcgacatgaccgtcggcggcgccccggcgggccggatc
gtgatggagctgtacgccaacgaggtgcccaagaccgcggagaacttccgcgcgctgtgc
acgggcgagaagggcgtgggcaagtccgggaagccgctccactacaagggctccaccttc
caccgcgtcatccccgagttcatgtgccagggcggcgacttcacccgcggcaacggcacc
ggcggcgagtccatctacggcgagaagttccccgacgagaagttcgtgcgcaagcacacc
gcccccggtgtgctctccatggccaacgccgggcccaacaccaacggctcccagttcttc
atctgcaccgtcgcgaccccttggctcgacggcaagcacgtcgtcttcggccaggtcgtc
gagggcatggacgtcgtcaaggccatcgagaaggtgggcacccgcaacggctccacctcc
aaggtggtcaaggtcgctgactgcggacagctctcctag

DBGET integrated database retrieval system