KEGG   Zea mays (maize): 103627916
Entry
103627916         CDS       T01088                                 

Definition
(RefSeq) large ribosomal RNA subunit accumulation protein YCED homolog 1, chloroplastic isoform X2
Organism
zma  Zea mays (maize)
SSDB
Motif
Pfam: YceD
Other DBs
NCBI-GeneID: 103627916
NCBI-ProteinID: XP_008646451
UniProt: A0A1D6HQ92 A0A1Q1AID3 A0A3L6ES11
Position
5
AA seq 293 aa
MYYPQPTVSLAAAVALLRPSLRRHSQRASSLLRSSTPPPWVSARRRTAVSDDFFTVELDA
TGVEPEPDSIDDGLPSPWEGAVVYRRDAAVQHLEYASTLERLGLGDLSSPDSRARAADLG
LAGGTLDSTGAQPRTPVLVSVDVTRRRGRLRLDGIVRTVITLGCFRCAEPAPQGIFANFS
LLLTEDPVEEEPDLGTIFQEDDDKGGASLACAMDGDQDIDWDDRLHFPAADKEIDISKHI
RDMIHLEITLDAVCNPNCKGLCLTCGANLNTTSSCTCKPRNVQGLSPLKGVFK
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtattatcctcagcctaccgtctccttggcggcggcggttgccctcctccgcccctca
ctccgccgccactctcaaagggcgtcatcccttctccgctcctccacgccgcctccatgg
gttagtgcgaggaggaggacggccgtctccgacgacttcttcaccgtcgagttggacgct
actggagtggaaccggaaccggattccatcgacgacgggctcccctctccatgggaggga
gctgtcgtctaccgccgcgacgctgccgtccagcacctcgagtacgccagcacgctggag
cgcctcggcctaggggacctctcctcccccgactcccgcgcgcgcgccgctgacctgggc
ctggctggagggaccctggacagcactggcgcgcagcctcggacccccgtgctcgtctcc
gtcgacgtgaccaggcgccgcggccgcctgcgcctggacggcatcgtgcgcaccgtcatc
accctcggctgcttcaggtgtgctgagccagctcctcaaggtatatttgccaatttctcc
ctgctgttgacagaagacccagtagaggaggaaccagacctcggcacgatttttcaagag
gacgacgacaaaggtggtgcttcgctagcctgcgccatggatggagatcaagatatcgac
tgggatgaccggctgcatttcccagcagctgacaaggaaatcgatatatccaagcacatc
cgggacatgattcatctggagatcaccttggatgcagtgtgcaaccccaactgcaagggt
ctatgccttacctgcggcgcaaacctcaacaccaccagcagctgcacatgcaagcccagg
aacgtccaaggactttctcctctcaaaggggttttcaagtga

DBGET integrated database retrieval system