KEGG   Zea mays (maize): 103628815
Entry
103628815         CDS       T01088                                 

Definition
(RefSeq) zinc finger protein 1
Organism
zma  Zea mays (maize)
SSDB
Motif
Pfam: zf-C2H2_6 zf-C2H2_4 zf-C2H2
Other DBs
NCBI-GeneID: 103628815
NCBI-ProteinID: XP_008647162
UniProt: A0A1D6HGL7
Position
5
AA seq 139 aa
MLMRMLQVVVACLRVPAVAALKDQHVAVAVREPVTSSTYDGAAAGRVHRCTICHKEFSTG
QALGGHKRKHYDGGAAAAETSEVGSSGNGISAPRAFDLNLPVVPEFAFRCGGKPSKMWEE
DEEVQSPLAFKKPFLLMTA
NT seq 420 nt   +upstreamnt  +downstreamnt
atgctcatgaggatgttgcaggtggtcgtcgcatgcctccgtgtacccgccgtggccgct
ctcaaggaccaacatgtcgcggtcgccgtccgtgagccggtcacgtcgtccacctacgac
ggggcggccgcgggcagagtgcacaggtgcaccatctgccacaaggagttctcgaccggc
caggcgctcggcgggcacaagaggaagcactacgatggaggcgccgcggcagccgagacg
tccgaggtggggagctctgggaacggaatctccgccccccgcgcgttcgacctgaacctc
ccggtcgtgccggagttcgccttccggtgcggcggcaagcccagcaagatgtgggaggag
gacgaggaggtgcagagccccctcgccttcaagaagcccttcctcctcatgaccgcgtga

DBGET integrated database retrieval system